| PDBID: | 9bad | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8gma | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-24 | | Release date: | 2024-09-25 |
|
| PDBID: | 8vwm | | Status: | HPUB -- hold until publication | | Title: | A structural study of selectivity mechanisms for JNK3 and p38 alpha with indazole scaffold probing compounds | | Authors: | Park, H., Feng, Y. | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8vwo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8iur | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of a polyketide decarboxylase Abx(+)O from Actinomycetes sp. MA7150 | | Authors: | Luo, S., Zhu, C., Jiang, K., Qu, X. | | Deposition date: | 2023-03-24 | | Release date: | 2024-09-24 |
|
| PDBID: | 9b9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
| PDBID: | 8vwl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Vibrio cholerae NFeoB in the apo form | | Authors: | Lee, M., Smith, A.T. | | Deposition date: | 2024-02-01 |
|
| PDBID: | 9b3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8vwn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Vibrio cholerae NFeoB in the GDP-bound form | | Authors: | Lee, M., Smith, A.T. | | Deposition date: | 2024-02-01 |
|
| PDBID: | 9b3x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9ba0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8gmj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-26 | | Release date: | 2024-10-31 |
|
| PDBID: | 8vws | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vwu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 9bae | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8vwx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 9b9u | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS CoV-2 full-length spike protein with His1271Lys substitution in the coatomer binding motif, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8vwt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vwv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 9ba4 | | Status: | HOLD -- hold until a certain date | | Title: | full-length cross-linked Contactin 2 (CNTN2) | | Authors: | Liu, J.L., Fan, S.F., Ren, G.R., Rudenko, G.R. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 8ivc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-03-27 | | Release date: | 2024-10-09 |
|
| PDBID: | 9b9q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8vww | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
