| PDBID: | 8r3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8r3w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a homospecific CR57 diabody | | Authors: | Kedari, A., Rissanen, I. | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8x2x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8x2y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8x2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8x30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8x2o | | Status: | HOLD -- hold until a certain date | | Title: | RIPK2 in complex with K252 | | Authors: | Yang, J.H., Yang, J.H. | | Deposition date: | 2023-11-10 | | Release date: | 2024-11-10 |
|
| PDBID: | 8x31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8x32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8x33 | | Status: | HPUB -- hold until publication | | Title: | crystal structure of the CobH-like domain in cobalt regulator CoaR | | Authors: | Liu, X. | | Deposition date: | 2023-11-10 |
|
| PDBID: | 8uxv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8uxz | | Status: | HPUB -- hold until publication | | Title: | Structure of E. coli acetyl-CoA carboxylase (local reconstruction of the wide helical tube at 3.31 Angstrom resolution) | | Authors: | Xu, X., Silva de Sousa, A., Boram, T.J., Jiang, W., Lohman, R.J. | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8uxy | | Status: | HPUB -- hold until publication | | Title: | Consensus olfactory receptor consOR1 bound to L-menthol and in complex with mini-Gs trimeric protein | | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8uy0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-11 |
|
| PDBID: | 8uy3 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Fem1B with FNIP1 and Tom20 fragment | | Authors: | Gee, C.L., Manford, A.G., McMinimy, R., Rape, M. | | Deposition date: | 2023-11-12 | | Release date: | 2024-11-12 |
|
| PDBID: | 8r44 | | Status: | HPUB -- hold until publication | | Title: | PAS-GAF bidomain of Glycine max phytochrome A | | Authors: | Guan, K., Nagano, S., Hughes, J. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8r45 | | Status: | HPUB -- hold until publication | | Title: | Phytochromobilin-adducted PAS-GAF bidomain of Glycine max phytochrome A | | Authors: | Guan, K., Chen, P., Nagano, S., Hughes, J. | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8r4a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8r4f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the native copper efflux oxidase (CueO) from Hafnia alvei | | Authors: | Leone, P., Contaldo, U. | | Deposition date: | 2023-11-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8r4k | | Status: | HPUB -- hold until publication | | Title: | Plastidial phosphorylase Pho1 trimer from Solanum tuberosum | | Authors: | Koulas, S.M., Leonidas, D.D. | | Deposition date: | 2023-11-13 | | Sequence: | >Entity 1
TLSEKIHHPITEQGGESDLSSFAPDAASITSSIKYHAEFTPVFSPERFELPKAFFATAQSVRDSLLINWNATYDIYEKLNMKQAYYLSMEFLQGRALLNAIGNLELTGAFAEALKNLGHNLENVASQEPDAALGNGGLGRLASCFLDSLATLNYPAWGYGLRYKYGLFKQRITKDGQEEVAEDWLEIGSPWEVVRNDVSYPIKFYGKVSTGSDGKRYWIGGEDIKAVAYDVPIPGYKTRTTISLRLWSTQVPSADFDLSAFNAGEHTKACEAQANAEKICYILYPGDESEEGKILRLKQQYTLCSASLQDIISRFERRSGDRIKWEEFPEKVAVQMNDTHPTLCIPELMRILIDLKGLNWNEAWNITQRTVAYTNHTVLPEALEKWSYELMQKLLPRHVEIIEAIDEELVHEIVLKYGSMDLNKLEEKLTTMRILENFDLPSSVAELFIKPEISVDDDTETVEVHDKVEASDKVVTNDEDDTGKKTSVKIEAAAEKDIDKKTPVSPEPAVIPPKKVRMANLCVVGGHAVNGVAEIHSEIVKEEVFNDFYELWPEKFQNKTNGVTPRRWIRFCNPPLSAIITKWTGTEDWVLKTEKLAELQKFADNEDLQNEWREAKRSNKIKVVSFLKEKTGYSVVPDAMFDIQVKRIHEYKRQLLNIFGIVYRYKKMKEMTAAERKTNFVPRVCIFGGKAFATYVQAKRIVKFITDVGATINHDPEIGDLLKVVFVPDYNVSVAELLIPASDLSEHISTAGMEASGTSNM(LLP)FAMNGCIQIGTLDGANVEIREEVGEENFFLFGAQAHEIAGLRKERADGKFVPDERFEEVKEFVRSGAFGSYNYDDLIGSLEGNEGFGRADYFLVGKDFPSYIECQEKVDEAYRDQKRWTTMSILNTAGSYKFSSDRTIHEYAKDIWNIEAVEIA
|
|
| PDBID: | 8r4h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the copper efflux oxidase (CueO) from Hafnia alvei deleted of the Met-rich domain | | Authors: | Leone, P., Contaldo, U. | | Deposition date: | 2023-11-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8uy7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uya | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
| PDBID: | 8uy8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-13 |
|
