PDBID: | 8pu5 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Acyl-CoA dehydrogenase FadE1(PA0506) E441A from Pseudomonas aeruginosa complexed with C16CoA | Authors: | Wang, M., Brear, P., Welch, M. | Deposition date: | 2023-07-16 | Release date: | 2025-01-16 |
|
PDBID: | 8k3o | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu1 | Status: | HPUB -- hold until publication | Title: | Structure of the toxin/antitoxin complex FaRel/ATfaRel2 with APCPP | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu2 | Status: | HPUB -- hold until publication | Title: | Structure of the antitoxin ATfaRel2 | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu3 | Status: | HPUB -- hold until publication | Title: | Complex of the toxin/antitoxin FaRel2/ATfaRel2 | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8pu4 | Status: | HPUB -- hold until publication | Title: | FaRel2 bound to the ATP analogue, APCPP | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | Deposition date: | 2023-07-16 |
|
PDBID: | 8puk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8pul | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8pup | Status: | HPUB -- hold until publication | Title: | Influenza A/California/07/2009(H1N1) endonuclease in complex with purpurogallin-like compound | Authors: | Kotacka, T., Radilova, K. | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8pv0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 |
|
PDBID: | 8puz | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 |
|
PDBID: | 8puu | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-17 | Release date: | 2025-01-17 |
|
PDBID: | 8puj | Status: | HPUB -- hold until publication | Title: | The surface-exposed lipo-protein of BtuG2 in complex with cyanocobalamin. | Authors: | Whittaker, J., Martinez-Felices, J.M., Guskov, A., Slotboom, D.J. | Deposition date: | 2023-07-17 |
|
PDBID: | 8k48 | Status: | HPUB -- hold until publication | Title: | LTD of arabidopsis thaliana | Authors: | Wang, C., Xu, X.M. | Deposition date: | 2023-07-17 |
|
PDBID: | 8tho | Status: | HPUB -- hold until publication | Title: | Solution structure of the zinc finger repeat domain of BCL11A (ZnF456) | Authors: | Viennet, T., Yin, M., Orkin, S.H., Arthanari, H. | Deposition date: | 2023-07-17 | Sequence: | >Entity 1 SEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
|
|
PDBID: | 8thq | Status: | HPUB -- hold until publication | Title: | Nonamer RNA bound to hAgo2-PAZ | Authors: | Pallan, P.S., Harp, J.M., Egli, M. | Deposition date: | 2023-07-17 |
|
PDBID: | 8pvr | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-18 |
|
PDBID: | 8pvy | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the human BRISC dimer complex bound to compound FX-171-C | Authors: | Chandler, F., Zeqiraj, E. | Deposition date: | 2023-07-18 | Release date: | 2025-01-18 |
|
PDBID: | 8pvw | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-18 |
|
PDBID: | 8pvq | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human PTX3 C-terminal domain | Authors: | Levy, C.W. | Deposition date: | 2023-07-18 |
|
PDBID: | 8pvu | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-18 | Release date: | 2025-01-18 |
|
PDBID: | 8pvx | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-18 |
|
PDBID: | 8k4e | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-18 |
|
PDBID: | 8k4d | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-18 |
|
PDBID: | 8k4g | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-18 | Release date: | 2025-01-18 |
|