PDBID: | 9c69 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase, Cad1-CARF in the cA4 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c68 | Status: | HPUB -- hold until publication | Title: | The CRISPR associated CARF-adenosine deaminase Cad1-CARF in the cA6 bound form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6n | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-07 |
|
PDBID: | 9c65 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 | Sequence: | >Entity 1 STLEVRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
|
|
PDBID: | 9c6o | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Multiple independent acquisitions of ACE2 usage in MERS-related coronaviruses | Authors: | Park, Y.J., Seattle Structural Genomics Center for Infectious Diseases, Veesler, D., Seattle Structural Genomics Center for Infectious Disease (SSGCID) | Deposition date: | 2024-06-07 |
|
PDBID: | 9c62 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6b | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6c | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form with ATP (symmetric sites). | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6j | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6e | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6f | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form with ATP (Asymmetric sites). | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6k | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6g | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Mcm double hexamer from human | Authors: | Liu, C., Xu, N., Lin, Q. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6l | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c63 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c64 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 9c67 | Status: | HPUB -- hold until publication | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form | Authors: | Majumder, P., Patel, D.J. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c66 | Status: | HPUB -- hold until publication | Title: | Structure of the Mena EVH1 domain bound to the polyproline segment of PTP1B | Authors: | LaComb, L., Fedorov, E., Bonanno, J.B., Almo, S.C., Ghosh, A. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6h | Status: | HPUB -- hold until publication | Title: | [d3] Tensegrity triangle with deazapurine center strand (strand 3) in R3 | Authors: | Vecchioni, S., Sha, R., Ohayon, Y., Galindo, M., Lopez-Chamorro, C., Jong, M. | Deposition date: | 2024-06-07 |
|
PDBID: | 9c6i | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-07 |
|
PDBID: | 8zud | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Human Myt1 Kinase domain Bounded with compound 39 | Authors: | Zhang, Z.M., Zhou, Z.Q. | Deposition date: | 2024-06-08 |
|
PDBID: | 8zue | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-08 |
|
PDBID: | 8zu6 | Status: | HPUB -- hold until publication | Title: | Solution NMR Structure of PACT D3 Homodimer | Authors: | Zhao, L., Ahmad, S., Hur, S., Chou, J. | Deposition date: | 2024-06-08 |
|
PDBID: | 8zub | Status: | HPUB -- hold until publication | Title: | The Crystal structure of mol075 bound to the main protease (3CLpro/Mpro) of SARS-CoV-2 | Authors: | Yan, M., Zhang, H. | Deposition date: | 2024-06-08 |
|
PDBID: | 8zu9 | Status: | HPUB -- hold until publication | Title: | The complex structure of MPXV M1R and neutralizing antibody A129 | Authors: | Ge, J.W. | Deposition date: | 2024-06-08 |
|