| PDBID: | 8ypk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypm | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in prime-activation conformation | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypl | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric phosphomimetic mutant of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypp | | Status: | HPUB -- hold until publication | | Title: | Structure of the tetrameric trans-autophosphorylation complex of Tribolium castaneum (Tc) PINK1 | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypq | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Liu, Z., Mi, L.Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypn | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypo | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypg | | Status: | HPUB -- hold until publication | | Title: | NleA oligomer in the bent form | | Authors: | Machida, S., Sivaraman, J. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2v | | Status: | HPUB -- hold until publication | | Title: | SARS CoV-2 Spike protein Ectodomain with internal tag, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2y | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Kynurenine monooxygenase from Pseudomonas fluorescens complexed with 4-chlorophenylacetyltetrazole | | Authors: | Phillips, R.S., Ma, W. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2w | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-17 | | Release date: | 2025-03-17 |
|
| PDBID: | 9epc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Plastid-encoded RNA polymerase from Sinapis alba | | Authors: | Effantin, G., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9ep8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor | | Authors: | Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9epa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epk | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9ep7 | | Status: | HPUB -- hold until publication | | Title: | Poecitoxin-1a from Poecilotheria subfusca spider, a new potent peptide blocker of the human Cav1.2 channel subtype | | Authors: | Kurz, M., Kurz, M. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epf | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Human Picobirnavirus CP VLP | | Authors: | Rodriguez-Espinosa, M.J., Novoa, G., Martinez-Romero, J.M., de Pablo, P.J., Caston, J.R. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epd | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 8 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epg | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9eph | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epi | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9ep9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
