| PDBID: | 9eu2 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
| PDBID: | 8xge | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9eu4 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MQQKYQPTEANLKARSEFQDNKFGIFLHWGLYAMLATGEWTMTNNNLNYKEYAKLAGGFYPSKFDADKWVAAIKASGAKYICFTTRHHEGFSMFDTKYSDYNIVKATPFKRDVVKELADACAKHGIKLHFYYSHIDWYREDAPQGRTGRRTGRPNPKGDWKSYYQFMNNQLTELLTNYGPIGAIWFDGWWDQDINPDFDWELPEQYALIHRLQPACLVGNNHHQTPFAGEDIQIFERDLPGENTAGLSGQSVSHLPLETCETMNGMWGYKITDQNYKSTKTLIHYLVKAAGKDANLLMNIGPQPDGELPEVAVQRLKEVGEWMSKYGETIYGTRGGLVAPHDWGVTTQKGNKLYVHILNLQDKALFLPIVDKKVKKAVVFADKTPVRFTKNKEGIVLELAKVPTDVDYVVELTIDDEHHHHHH
|
|
| PDBID: | 8xgh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9etz | | Status: | HPUB -- hold until publication | | Title: | III2IV respiratory supercomplex from Saccharomyces cerevisiae | | Authors: | Moe, A., Brzezinski, P. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8xgi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9eqg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9ev2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xgm | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human GPR1 bound to chemerin | | Authors: | Liu, A.J., Liu, Y.Z., Ye, R.D. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9euv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xgl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9ev3 | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum pyruvate:quinone oxidoreductase (PQO) purified from bacteria grown in acetate minimal medium | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xgp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9eut | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xgo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9ev4 | | Status: | HPUB -- hold until publication | | Title: | Pyruvate:quinone oxidoreductase (PQO) from Corynebacterium glutamicum CS176 | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xgn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9ev6 | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum pyruvate:quinone oxidoreductase (PQO), C-terminal truncated construct | | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xgq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9euw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xgs | | Status: | HPUB -- hold until publication | | Title: | a peptide receptor complex structure | | Authors: | Wu, Z., Du, Y., Chen, G. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9ev0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8gdt | | Status: | HPUB -- hold until publication | | Title: | Heligmosomoides polygyrus TGF-beta Mimic 6 Domain 3 (TGM6-D3) Bound to Human TGF-beta Type II Receptor Extracellular Domain | | Authors: | White, S.E., Schwartze, T.A., Hinck, A.P. | | Deposition date: | 2023-03-06 | | Release date: | 2024-09-11 |
|
| PDBID: | 8xgu | | Status: | HPUB -- hold until publication | | Title: | a peptide receptor complex structure | | Authors: | Wu, Z., Du, Y., Chen, G. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9eux | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
