| PDBID: | 8vwr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8vwy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y68 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y6e | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y69 | | Status: | HPUB -- hold until publication | | Title: | LGR4-RSPO2-ZNRF3 (2:2:2) | | Authors: | Wang, L. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y6f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y6j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvy | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the adenosine A2A receptor in complex with Istradefylline | | Authors: | Glover, H. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Trypanosoma congolense pyruvate kinase in complex with a single-domain antibody (TcoPYK-sdAb42) in the presence of sulfate | | Authors: | Sterckx, Y.G.-J. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rvz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8y6g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 | | Sequence: | >Entity 1
QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYPMSWVRQAPGKGLEWVSDINSSGTTYYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCATEGKYGRTWYGQLEYHYWGQGTQVTVSEHHHHHH
>Entity 2
MHHHHHHESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTYTVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGEITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAE
|
|
