| PDBID: | 9b2j | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2m | | Status: | HPUB -- hold until publication | | Title: | Hemagglutinin H1 New Caledonia 1999 in complex with monoclonal antibody Fab 43_S0008 | | Authors: | Torrents de la Pena, A., de Paiva Froes Rocha, R., Ward, A.B., Ataca, S., Kanekiyo, M. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of short chain dehydrogenase reductase 9 (short chain dehydrogenase reductase 9C4) in complex with NAD+ | | Authors: | Pakhomova, S., Belyaeva, O.V., Boeglin, W.E., Kedishvili, N.Y., Brash, A.R., Newcomer, M.E., Popov, K.M. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MLFWLLALLFLCAFLWNYKGQLKIADIADKYVFITGCDTGFGNLAARTFDKKGFRVIAACLTESGSAALKAKTSERLHTVLLDVTDPENVKKTAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTELADPIKTTEKKLAIWKHLSPDIKQQYGEGYIEKSLHRLKSNTSSVNLDLSLVVGCMDHALTSLFPKTRYIAGKDAKTFWIPLSHMPAVLQDFLLLKQKVELANPKAV
|
|
| PDBID: | 9b2g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of short chain dehydrogenase reductase 9 (short chain dehydrogenase reductase 9C4) in complex with NADH | | Authors: | Pakhomova, S., Belyaeva, O.V., Boeglin, W.E., Kedishvili, N.Y., Brash, A.R., Newcomer, M.E., Popov, K.M. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MLFWLLALLFLCAFLWNYKGQLKIADIADKYVFITGCDTGFGNLAARTFDKKGFRVIAACLTESGSAALKAKTSERLHTVLLDVTDPENVKKTAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTELADPIKTTEKKLAIWKHLSPDIKQQYGEGYIEKSLHRLKSNTSSVNLDLSLVVGCMDHALTSLFPKTRYIAGKDAKTFWIPLSHMPAVLQDFLLLKQKVELANPKAV
|
|
| PDBID: | 9b2k | | Status: | HPUB -- hold until publication | | Title: | SpCas9 with dual-guide RNA in open conformation | | Authors: | Korolev, S., Gagnon, K. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Pantothenate Synthetase from Candida albicans. | | Authors: | Regan, J., Avad, K.A., Alaidi, O., Seetharaman, J., Palmer, G.E., Hevener, K.E. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2e | | Status: | HPUB -- hold until publication | | Title: | DHNA associated with an inhibitor | | Authors: | Czeczot, A.M., Silva, E.E.D., Timmers, L.F.S.M., Machado, P., Basso, L.A., Bizarro, C.V. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eos | | Status: | HPUB -- hold until publication | | Title: | Human serum albumin with myristate | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLL
|
|
| PDBID: | 9eoy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-15 | | Release date: | 2025-03-15 |
|
| PDBID: | 9eol | | Status: | HPUB -- hold until publication | | Title: | N-acetylglucosamine 6-phosphate dehydratase: inhibited 6-phosphogluconic acid state of NagS | | Authors: | McNae, I.W., Abrahams, J.P., Li, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eok | | Status: | POLC -- waiting for a policy decision | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eom | | Status: | HPUB -- hold until publication | | Title: | 250A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eon | | Status: | HPUB -- hold until publication | | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eot | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eoo | | Status: | HPUB -- hold until publication | | Title: | 260A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eop | | Status: | HPUB -- hold until publication | | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9eov | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8ype | | Status: | HOLD -- hold until a certain date | | Title: | The crystal structure of inactive p38 complexed with a ATF2 from 46 to 80 | | Authors: | Zhang, Y.Y., Pei, C.J., He, Q.Q., Luo, Z.P., Wu, J.W., Wang, Z.X. | | Deposition date: | 2024-03-16 | | Release date: | 2025-03-16 |
|
| PDBID: | 8ypf | | Status: | HOLD -- hold until a certain date | | Title: | The crystal structure of inactive p38 complexed with a ATF2 from 46 to 90 | | Authors: | Zhang, Y.Y., Pei, C.J., He, Q.Q., Luo, Z.P., Wu, J.W., Wang, Z.X. | | Deposition date: | 2024-03-16 | | Release date: | 2025-03-16 |
|
| PDBID: | 8ypa | | Status: | HPUB -- hold until publication | | Title: | Human mitochondrial ClpP in complex with TR89 | | Authors: | Li, Q.-N., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8ypb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8ypc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human pannexin 3 in phosphorylated state | | Authors: | Hang, Z., Huawei, Z., Daping, W. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8ypd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the LH1 complex from Allochromatium tepidum | | Authors: | Wang, G.-L., Sun, S., Yu, L.-J. | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9b2s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-16 |
|
