PDBID: | 8uy9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uya | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uyb | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uyc | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uyq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Consensus olfactory receptor consOR4 bound to 2-methylthiazoline and in complex with mini-Gs trimeric protein | Authors: | Billesboelle, C.B., Del Torrent, C.L., Manglik, A. | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy6 | Status: | HPUB -- hold until publication | Title: | Aquaporin Z with ALFA tag and bound to nanobody | Authors: | Stover, L., Bahramimoghaddam, H., Wang, L., Zhou, M., Laganowsky, A. | Deposition date: | 2023-11-13 |
|
PDBID: | 8uy5 | Status: | HPUB -- hold until publication | Title: | [ZP] Self-assembling DNA crystal with expanded genetic code using C,A,T,G, Z and P nucleotides | Authors: | Vecchioni, S., Sha, R., Ohayon, Y.P., Hernandez, C. | Deposition date: | 2023-11-13 |
|
PDBID: | 8uyn | Status: | HPUB -- hold until publication | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | Authors: | Rupert, P.B., Strong, R.K. | Deposition date: | 2023-11-13 | Sequence: | >Entity 1 QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
PDBID: | 8x3y | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-11-14 | Release date: | 2024-11-14 |
|
PDBID: | 8x3z | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-14 |
|
PDBID: | 8x3o | Status: | HOLD -- hold until a certain date | Title: | Structure of Cyclic Rev | Authors: | Kim, D., Lim, Y., Barnwal, R.P. | Deposition date: | 2023-11-14 | Release date: | 2024-11-14 |
|
PDBID: | 8x3m | Status: | HPUB -- hold until publication | Title: | Crystal structure of p38alpha with an allosteric inhibitor 2 | Authors: | Hasegawa, S., Kinoshita, T. | Deposition date: | 2023-11-14 |
|
PDBID: | 8x3q | Status: | HPUB -- hold until publication | Title: | tll1591 with alpha-glucan 4sugar | Authors: | Su, J.Y. | Deposition date: | 2023-11-14 |
|
PDBID: | 8x3p | Status: | HOLD -- hold until a certain date | Title: | Structure of linear Rev | Authors: | Kim, D., Lim, Y., Barnwal, R.P. | Deposition date: | 2023-11-14 | Release date: | 2024-11-14 |
|
PDBID: | 8x3u | Status: | HPUB -- hold until publication | Title: | tll1591 with alpha_glucan 3sugar | Authors: | Su, J.Y. | Deposition date: | 2023-11-14 |
|
PDBID: | 8x3t | Status: | HPUB -- hold until publication | Title: | Structure of LGR4 with NB21 | Authors: | Wang, L., Geng, Y. | Deposition date: | 2023-11-14 |
|
PDBID: | 8x41 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-14 |
|
PDBID: | 8x42 | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with YH20195 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-14 |
|
PDBID: | 8x3x | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-11-14 | Release date: | 2024-11-14 |
|
PDBID: | 8x3v | Status: | HPUB -- hold until publication | Title: | Crystal structure of 2C from encephalomyocarditis virus bound with ATP | Authors: | Zhang, H., Zhao, H., Dong, Y.H. | Deposition date: | 2023-11-14 |
|
PDBID: | 8x3w | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-14 |
|
PDBID: | 8x3l | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-11-14 | Release date: | 2024-11-14 |
|
PDBID: | 8r4n | Status: | HPUB -- hold until publication | Title: | Crystal structure of neutralizing Fab Eq4.Dp46-3A from equine antivenom bound to short chain three finger alpha-neurotoxin from Dendroaspis polylepis. | Authors: | Wibmer, C.K. | Deposition date: | 2023-11-14 |
|