| PDBID: | 8wgy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MPOX E5 hexamer AMP-PNP and ssDNA bound form with clear primase domain | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh6 | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 hexamer ADP and ssDNA bound and clear primase domain conformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh2 | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 hexamer 2ATP, 2ADP, and ssDNA binding comformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh1 | | Status: | PROC -- to be processed | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh4 | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 hexamer ssDNA bound apo conformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wh0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MPOX E5 hexamer ssDNA and AMP-PNP bound conformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8wgz | | Status: | HPUB -- hold until publication | | Title: | MPOX E5 double hexamer ssDNA bound conformation | | Authors: | Zhang, Z., Dong, C. | | Deposition date: | 2023-09-22 |
|
| PDBID: | 8ubi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 | | Release date: | 2025-02-28 |
|
| PDBID: | 8ubj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 | | Release date: | 2025-02-28 |
|
| PDBID: | 8ubl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 | | Release date: | 2025-02-28 |
|
| PDBID: | 8ubm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 | | Release date: | 2025-02-28 |
|
| PDBID: | 8ubn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 | | Release date: | 2025-02-28 |
|
| PDBID: | 8ubo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 | | Release date: | 2025-02-28 |
|
| PDBID: | 8ubp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 | | Release date: | 2025-02-28 |
|
| PDBID: | 8ubk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 | | Release date: | 2025-02-28 |
|
| PDBID: | 8whn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-23 | | Release date: | 2025-03-26 |
|
| PDBID: | 8whd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whg | | Status: | HPUB -- hold until publication | | Title: | imine reductase mutant - M3 | | Authors: | Zhu, X.X., Chen, X.R., Zheng, G.W. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8who | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH20541 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH21398 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 | | Sequence: | >Entity 1
GSHMVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPELGPALTYVAGFTGFHQFAEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLLQIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTLEAKQLVG
|
|
| PDBID: | 8whp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH201042 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
