| PDBID: | 9epu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human CDKL5 kinase domain with compound CAF-382 | | Authors: | Richardson, W., Chen, X., Newman, J.A., Bakshi, S., Lakshminarayana, B., Brooke, L., Bullock, A.N. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 9eq6 | | Status: | HPUB -- hold until publication | | Title: | Cachd1 and FZD5 complex | | Authors: | Zhao, Y., Ren, J., Jones, E.Y. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8xbb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8j4y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-21 | | Release date: | 2024-10-30 |
|
| PDBID: | 8xbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 9eqa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9eq9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8xba | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xb7 | | Status: | HOLD -- hold until a certain date | | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 2.6 angstrom resolution | | Authors: | Goswami, A., Raju, R., Kasarla, M. | | Deposition date: | 2023-12-06 | | Release date: | 2024-12-06 |
|
| PDBID: | 9eq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9eqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8xbm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8j6a | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the cellulose-swelling protein in filamentous fungus | | Authors: | Watanabe, M., Nakamichi, Y., Morita, T. | | Deposition date: | 2023-04-25 | | Release date: | 2024-10-30 |
|
| PDBID: | 9eqc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8xbj | | Status: | HPUB -- hold until publication | | Title: | The X-ray structure of F46C myoglobin with a covalently linked Ni-complex | | Authors: | Lin, Y.W., Yuan, H. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 9eqe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8xbn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Arabidopsis N-amino acetyltransferase NATA1 bound to CoA and HEPES | | Authors: | Hameed, U.F.S., Arold, S.T. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8j8s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of HcKCR1-D116N | | Authors: | Zhang, M.F. | | Deposition date: | 2023-05-02 | | Release date: | 2024-08-02 |
|
| PDBID: | 9eqd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8xbp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtNATA1 bound to Acetyl CoA | | Authors: | Hameed, U.F.S., Arold, S.T. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8j93 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HcKCR1-C110T-all trans RET | | Authors: | Zhang, M.F. | | Deposition date: | 2023-05-02 | | Release date: | 2024-08-02 |
|
| PDBID: | 9eqi | | Status: | HPUB -- hold until publication | | Title: | Hydrogenase-1 Ni-B state poised at +100mV | | Authors: | Carr, S.B., Li, W., Wong, K.l., Ash, P.A., Vincent, K.A. | | Deposition date: | 2024-03-21 | | Sequence: | >Entity 1
LENKPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVVDIPRSHHHHHH
>Entity 2
MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALASVYAIEDAIGIKVPDNANIIRNIMLATLWCHDHLVHFYQLAGMDWIDVLDALKADPRKTSELAQSLSSWPKSSPGYFFDVQNRLKKFVEGGQLGIFRNGYWGHPQYKLPPEANLMGFAHYLEALDFQREIVKIHAVFGGKNPHPNWIVGGMPCAINIDESGAVGAVNMERLNLVQSIITRTADFINNVMIPDALAIGQFNKPWSEIGTGLSDKCVLSYGAFPDIANDFGEKSLLMPGGAVINGDFNNVLPVDLVDPQQVQEFVDHAWYRYPNDQVGRHPFDGITDPWYNPGDVKGSDTNIQQLNEQERYSWIKAPRWRGNAMEVGPLARTLIAYHKGDAATVESVDRMMSALNLPLSGIQSTLGRILCRAHEAQWAAGKLQYFFDKLMTNLKNGNLATASTEKWEPATWPTECRGVGFTEAPRGALGHWAAIRDGKIDLYQCVVPTTWNASPRDPKGQIGAYEAALMNTKMAIPEQPLEILRTLHSFDPCLACSTH
|
|
| PDBID: | 8j96 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | HcKCR1-W199L-8-cis,13-cis RET | | Authors: | Zhang, M.F. | | Deposition date: | 2023-05-02 | | Release date: | 2024-09-02 |
|
| PDBID: | 8x8d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with four GlnR and two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 9eql | | Status: | HPUB -- hold until publication | | Title: | Hydrogenase-1 Ni-B state poised at +300mV | | Authors: | Carr, S.B., Li, W., Wong, K.l., Ash, P.A., Vincent, K.A. | | Deposition date: | 2024-03-21 | | Sequence: | >Entity 1
LENKPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVVDIPRSHHHHHH
>Entity 2
MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALASVYAIEDAIGIKVPDNANIIRNIMLATLWCHDHLVHFYQLAGMDWIDVLDALKADPRKTSELAQSLSSWPKSSPGYFFDVQNRLKKFVEGGQLGIFRNGYWGHPQYKLPPEANLMGFAHYLEALDFQREIVKIHAVFGGKNPHPNWIVGGMPCAINIDESGAVGAVNMERLNLVQSIITRTADFINNVMIPDALAIGQFNKPWSEIGTGLSDKCVLSYGAFPDIANDFGEKSLLMPGGAVINGDFNNVLPVDLVDPQQVQEFVDHAWYRYPNDQVGRHPFDGITDPWYNPGDVKGSDTNIQQLNEQERYSWIKAPRWRGNAMEVGPLARTLIAYHKGDAATVESVDRMMSALNLPLSGIQSTLGRILCRAHEAQWAAGKLQYFFDKLMTNLKNGNLATASTEKWEPATWPTECRGVGFTEAPRGALGHWAAIRDGKIDLYQCVVPTTWNASPRDPKGQIGAYEAALMNTKMAIPEQPLEILRTLHSFDPCLACSTH
|
|
