PDBID: | 8vct | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vd6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcx | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vco | Status: | HPUB -- hold until publication | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcy | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8xg4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg9 | Status: | HPUB -- hold until publication | Title: | Crystal structure of phenylacetone monooxygenase mutant PM3 bound to FAD and NADP | Authors: | Li, X., Sun, Z.T. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of phenylacetone monooxygenase mutant PM1 bound to FAD and NADP | Authors: | Li, X., Sun, Z.T. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of phenylacetone monooxygenase mutant PM2 bound to FAD and NADP | Authors: | Li, X., Sun, Z.T. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgx | Status: | HPUB -- hold until publication | Title: | beta-1,4-galacosyltransferase | Authors: | Luo, G., Huang, Z., Chen, J., Hou, X., Zhu, Y., Ni, D., Xu, W., Zhang, W., Rao, Y., Mu, W. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgf | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgd | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xge | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgo | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgn | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgq | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgs | Status: | HPUB -- hold until publication | Title: | a peptide receptor complex structure | Authors: | Wu, Z., Du, Y., Chen, G. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgu | Status: | HPUB -- hold until publication | Title: | a peptide receptor complex structure | Authors: | Wu, Z., Du, Y., Chen, G. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgi | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgm | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human GPR1 bound to chemerin | Authors: | Liu, A.J., Liu, Y.Z., Ye, R.D. | Deposition date: | 2023-12-15 |
|