| PDBID: | 8xaf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8xag | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S-BQ.1 in complex with ACE2 | | Authors: | Hsu, H.F., Wu, M.H., Chang, Y.C., Hsu, S.T.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 9epn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9epq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8xb6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Portal-vertex of SH-Ab15497 in C1 symmetry | | Authors: | Lin, J., Zhao, S.W. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xb1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FLT3 in complex with a Pyrazinamide Macrocycle derivative | | Authors: | Guo, M., Chen, Y. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8j47 | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM Structure of 40-Residue Arctic (E22G) Beta-Amyloid Fibril Derived by Co-Analysis with Solid-State NMR | E22G Abeta40 | | Authors: | Tehrani, M.J., Matsuda, I., Yamagata, A., Matsunaga, T., Sato, M., Toyooka, K., Shirouzu, M., Ishii, Y., Kodama, Y., McElheny, D., Kobayashi, N. | | Deposition date: | 2023-04-19 | | Release date: | 2024-10-23 |
|
| PDBID: | 9eps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9epo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8xao | | Status: | HPUB -- hold until publication | | Title: | The thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 9epr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8xap | | Status: | HPUB -- hold until publication | | Title: | Thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8j4n | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-20 | | Release date: | 2024-10-20 |
|
| PDBID: | 9eq5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM Structure of Phenylalanine Ammonia Lyase from Planctomyces brasiliencis | | Authors: | Duhoo, Y., Buslov, I., Desmons, S. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8xaq | | Status: | HPUB -- hold until publication | | Title: | The thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8j4o | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of the Acinetobacter baumannii LysR family regulator AceR effector-binding domain with Spermidine | | Authors: | Ma, J.M., Ge, H.H. | | Deposition date: | 2023-04-20 | | Release date: | 2024-10-20 |
|
| PDBID: | 9eq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8xbl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 9ept | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Plastid Redox Insensitive 2 from Arabidopsis thaliana | | Authors: | Ruedas, R., Vallet, A., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8xbc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8j4v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-21 | | Release date: | 2024-10-30 |
|
| PDBID: | 9epu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human CDKL5 kinase domain with compound CAF-382 | | Authors: | Richardson, W., Chen, X., Newman, J.A., Bakshi, S., Lakshminarayana, B., Brooke, L., Bullock, A.N. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8xbk | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Liver Fructose-1,6-bisphosphatase Complexed with a Covalent Inhibitor | | Authors: | Cao, H., Zhang, X., Ren, Y., Wan, J. | | Deposition date: | 2023-12-06 |
|
