| PDBID: | 8wsx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wt0 | | Status: | HOLD -- hold until a certain date | | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wta | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cx26 from Gallus Gallus in bicarbonate buffer | | Authors: | Brotherton, D.H., Cameron, A.D. | | Deposition date: | 2023-10-18 | | Sequence: | >Entity 1
MDWGTLQAVLGGVNKHSTSIGKIWLTVLFIFRIMILVVAAERVWGDEQQDFVCNTLQPGCRNVCYDHFFPISHIRLWALQLIFVSTPALLVAMHVAYTRHERKRRFRSGDKINIEELKNEKIHIRGPLWWTYTCSIFFRIVFEAVFMYVFYYMYDGYQMPRLVKCDAWPCPNVVDCFVSRPTEKTTFTIFMLAVSGICMMLNLAELCYLVIKVCLKDSGKTTVLK
|
|
| PDBID: | 8qvr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-18 | | Release date: | 2024-10-18 |
|
| PDBID: | 8qvm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvk | | Status: | HPUB -- hold until publication | | Title: | Comparison of room-temperature and cryogenic structures of soluble Epoxide Hydrolase with ligands bound. | | Authors: | Dunge, A., Uwangue, O., Phan, C., Bjelcic, M., Gunnarsson, J., Wehlander, G., Kack, H., Branden, G. | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvh | | Status: | HPUB -- hold until publication | | Title: | Comparison of room-temperature and cryogenic structures of soluble Epoxide Hydrolase with ligands bound. | | Authors: | Dunge, A., Uwangue, O., Phan, C., Bjelcic, M., Gunnarsson, J., Wehlander, G., Kack, H., Branden, G. | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-18 | | Release date: | 2024-10-18 |
|
| PDBID: | 8qvf | | Status: | HPUB -- hold until publication | | Title: | Comparison of room-temperature and cryogenic structures of soluble Epoxide Hydrolase with ligands bound. | | Authors: | Dunge, A., Uwangue, O., Phan, C., Bjelcic, M., Gunnarsson, J., Wehlander, G., Kack, H., Branden, G. | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qw3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qw0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qw1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qw2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qw4 | | Status: | HPUB -- hold until publication | | Title: | FZD3 in complex with nanobody 9 | | Authors: | Zhao, Y., Jones, E.Y. | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8umz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-18 | | Release date: | 2024-10-18 |
|
| PDBID: | 8una | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a RecBCD mutant with RecB nuclease domain deletion | | Authors: | Hao, L., Zhang, R., Lohman, T.M. | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8unb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a RecBCD mutant with RecB nuclease domain deletion in complex with blunt-ended dsDNA | | Authors: | Hao, L., Zhang, R., Lohman, T.M. | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8une | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
