| PDBID: | 9egp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-21 | | Release date: | 2025-11-21 |
|
| PDBID: | 9kuo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9oiq | | Status: | PROC -- to be processed | | Title: | The von Hippel Lindau-ElonginB-ElonginC (VCB) complex with fragment 15 | | Authors: | Amporndanai, K., Katinas, J.M., Chopra, A., Fesik, S.W. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9ega | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9kun | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ligand-free trypanosome alternative oxidase | | Authors: | Ebiloma, G.U., Balogun, E.O., Dardonville, C., Shiba, T., De Koning, H.P. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9oip | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9egb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9kus | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9oiu | | Status: | HPUB -- hold until publication | | Title: | Soltion Structure of His6-Small Ubiquitin-like Modifier (His6-SUMO) | | Authors: | Mallett, T.M., Lamer, T.D., Vederas, J.C. | | Deposition date: | 2025-05-06 | | Sequence: | >Entity 1
MGSSHHHHHHGSGLVPRGSASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
|
|
| PDBID: | 9egg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9kv6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9ois | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of glycosyltransferase family 61 from Sorghum bicolor | | Authors: | Pereira, J.H., Wang, H.T., DeGiovanni, A.M., Scheller, H.V., Adams, P.D. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9egl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-3 | | Authors: | Shi, H., Zheng, N. | | Deposition date: | 2024-11-21 |
|
| PDBID: | 9kuu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Kv7.1 C-terminal Domain in Complex with Calmodulin disease mutation D130G | | Authors: | Liu, C. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9oiv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with 4W-0801 | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9e6b | | Status: | HOLD -- hold until a certain date | | Title: | Octopus sensory receptor CRT1 bound to Norharmane | | Authors: | Jiang, H., Hibbs, R.E. | | Deposition date: | 2024-10-29 | | Release date: | 2025-10-29 |
|
| PDBID: | 9kuw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9oiw | | Status: | PROC -- to be processed | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with GF-0701. | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9ehc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kuy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9oiy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with DA-0841 | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9eh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
| PDBID: | 9kux | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9oj1 | | Status: | PROC -- to be processed | | Title: | Structure of Undecaprenyl diphosphate synthase (UPPS) from Neisseria gonorrohea soaked with DA-0854. | | Authors: | Santiago, A.S., Llontop, E.E., Amaral, B.S., Ramos, P.Z., Piccirillo, E., Almeida, V.M., Barreiro, G., Massirer, K.B., Counago, R.M. | | Deposition date: | 2025-05-06 |
|
| PDBID: | 9ehe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-22 |
|
