| PDBID: | 9bwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwm | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Oxidized Tyr34Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Cone, E.A., Dasgupta, M., Lutz, W.E., Kumar, S., Natarajan, A., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-05-21 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAFVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 9bwk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9bwd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9fei | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9feg | | Status: | HPUB -- hold until publication | | Title: | PARP15 in complex with a quinazolin-4-one inhibitor | | Authors: | Bosetti, C., Lehtio, L. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9fej | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zlj | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, shut state) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 8zlm | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2024-05-20 | | Release date: | 2025-05-20 |
|
| PDBID: | 8zlg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zll | | Status: | HPUB -- hold until publication | | Title: | Apo state of hPAC | | Authors: | Chen, X., Su, N. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 8zlk | | Status: | HPUB -- hold until publication | | Title: | PWWP domain from human DNMT3B | | Authors: | Cho, C.-C., Yuan, H.S. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvi | | Status: | HPUB -- hold until publication | | Title: | Identification of multiple ligand hotspots on SOS2, compound 2 | | Authors: | Phan, J., Fesik, S.W. | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bv7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bv8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bv9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bva | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
| PDBID: | 9bvq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-20 |
|
