| PDBID: | 8rme | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8rmh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of parallel G-quadruplex containing T-tetrads and TG-octaplet | | Authors: | Abdullrahman, A., El Omari, K., Paterson, N., Orr, C., Lambert, M., Cardin, C.J., Sanchez-Weatherby, J., Hall, J.P. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8rmi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ferrioxamine transporter FoxA | | Authors: | Josts, I., Tidow, H., Mislin, G. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8rmt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8rmx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rmy | | Status: | HPUB -- hold until publication | | Title: | Transglutaminase 3 in complex with inhibitor Z-don and DH patient-derived Fab DH63-A02 | | Authors: | Heggelund, J.E., Sollid, L.M. | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rmz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rne | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rnf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 8rni | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnj | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnk | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with myristic acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnl | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with lauric acid | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnm | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with testosterone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnn | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with prednisone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rno | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with isophorone | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnp | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with R-limonene | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnq | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with dodecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rnr | | Status: | HPUB -- hold until publication | | Title: | Unspecific peroxygenase from Marasmius wettsteinii (MweUPO-1) in complex with tetradecane | | Authors: | Fernandez-Garcia, A., Sanz-Aparicio, J. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8rns | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase XII mimic in complex with biguanide derivative inhibitor 1-carbamimidamido-N-[(4 sulfamoylphenyl)methyl]methanimidamide | | Authors: | Baroni, C., Ferraroni, M. | | Deposition date: | 2024-01-10 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8rnz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
