| PDBID: | 8vj8 | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to Neutron Structure of Reduced Trp161Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-01-05 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8vj9 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant with the C edge loop from Arrestin2 inserted | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2024-01-06 | | Release date: | 2025-01-22 |
|
| PDBID: | 8vja | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of tail of bacteriophage Chi | | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | | Deposition date: | 2024-01-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8vjd | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8vje | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8vjf | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8vjg | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8vjh | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of tail-tip of bacteriophage Chi | | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | | Deposition date: | 2024-01-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8vji | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of capsid of bacteriophage Chi | | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | | Deposition date: | 2024-01-06 | | Release date: | 2025-01-06 |
|
| PDBID: | 8vjl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8vjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8vjq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-07 |
|
| PDBID: | 8vjt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vju | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vjz | | Status: | HPUB -- hold until publication | | Title: | HLA-A*03:01 with WT KRAS-10mer | | Authors: | Sim, M.J.W., Sun, P.D. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk6 | | Status: | HPUB -- hold until publication | | Title: | Amide-linked, extended 14alpha-demethylase (CYP51) with antifungal azole inhibitor | | Authors: | Tyndall, J.D.A., Monk, B.C., Simons, C. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8vk9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
