| PDBID: | 8vrl | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium smegmatis 50S ribosomal subunit bound to HflX and chloramphenicol:50S-HflX-A-Clm | | Authors: | Majumdar, S., Koripella, R.K., Sharma, M.R., Manjari, S.R., Banavali, N.K., Agrawal, R.K. | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vro | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrp | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor | | Authors: | Goldstone, D.C., Walsham, L. | | Deposition date: | 2024-01-22 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 8vrq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vry | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vs0 | | Status: | HPUB -- hold until publication | | Title: | A structural study of selectivity mechanisms for JNK3 and p38 alpha with indazole scaffold probing compounds | | Authors: | Park, H., Feng, Y. | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ADI-19425 Fab in complex with anti-idiotypic 2C1 Fab | | Authors: | Kher, G., Homad, L.J., McGuire, A.T., Pancera, M. | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vs8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ADI-19425 Fab in complex with anti-idiotypic 1D3 Fab | | Authors: | Kher, G., Homad, L.J., McGuire, A.T., Pancera, M. | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vsb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vsc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vsd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vse | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vsj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vsl | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3 sigma and ARAF phosphopeptide (pS214) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vsm | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 78 (1124378) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vsn | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 79 (1124379) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vso | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3 sigma, BRAF phosphopeptide (pS365) and compound 78 (1124378) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vsq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-24 |
|
