| PDBID: | 8uz2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uz3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uz9 | | Status: | HPUB -- hold until publication | | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
| PDBID: | 8uzc | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of UT14 Fab in complex with the head domain of H3 (A/Singapore/INFIMH-16-0019/2016) | | Authors: | Park, J., Georgiou, G. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uze | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8uzf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8uzg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8uzl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8uzp | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the Computationally Designed Influenza Hemagglutinin Epitope Scaffold stem_mimetic_01 bound by Antibody CR9501 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8uzq | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine in +1 active site | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8uzr | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound CMPCPP | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8uzs | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | RNA polymerase II elongation complex with 8-oxoguanine with 3'' CTP added | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8uzt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8uzv | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB02 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8uzz | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB03 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8v03 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-16 |
|
| PDBID: | 8v09 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0a | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the worst case of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with PGH | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0b | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB05 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0c | | Status: | HPUB -- hold until publication | | Title: | Structure of TDP1 catalytic domain complexed with compound IB06 | | Authors: | Lountos, G.T., Zhao, X.Z., Barakat, I., Wang, W., Agama, K., Al Mahmud, M.R., Pommier, Y., Burke Jr., T.R. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0d | | Status: | HPUB -- hold until publication | | Title: | Ubch5B-RING3 of MIB1 fusion structure | | Authors: | Cao, R., Blacklow, S.C. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0e | | Status: | HPUB -- hold until publication | | Title: | ANK repeat of MIB1 | | Authors: | Cao, R., Blacklow, S.C. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8v0j | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-17 |
|
