| PDBID: | 8wr3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8wrc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Time-Resolved Ambient Temperature Kineto-Crystallographic Structure of Initiation Factor in Complex with Ribosome | | Authors: | DeMirci, H., Yapici, I. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8wrf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MexL | | Authors: | Wei, Y., Wu, Z.K. | | Deposition date: | 2023-10-14 | | Release date: | 2025-04-14 | | Sequence: | >Entity 1
GSHMDPAKREAILEAAKRLFLCNGYDGSSMEAIASEAGVSKLTVYSHFTDKETLFSEAVKAKCAEQLPALYFQLAEGAPLEKVLLNIARGFHRLINSHEAIALTRLMAAQAGQNPKLSELFFEAGPKQVIDEMERLLEQARRSGKLAFPDARHAAEHFFMLVKGCANYRLLIGCAEPLDEAEGERHVEEVVALFLRAFAAGG
|
|
| PDBID: | 8wrp | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1 with 20 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrq | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1 with 14 nt complementary heteroduplex | | Authors: | Zhang, K., Zhang, X. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrr | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1 with 10 nt complementary heteroduplex | | Authors: | Zhang, X., Zhang, K. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrs | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1 with 5 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrt | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1/crRNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wru | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrv | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wrw | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1-N1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wry | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ws0 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human NEK7 S195D mutant | | Authors: | Bijpuria, S., Athresh, S., Subbiah, R., Mollard, A., Bearss, D. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws1 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human NEK7 D161N mutant | | Authors: | Bijpuria, S., Kanavalli, M., Subbiah, R., Mollard, A., Bearss, D. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ws5 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1-N2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws6 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1 with 14 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws7 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1 with 10 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws8 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8ws9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM mini structure of Cas12-1 with 5 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-17 | | Release date: | 2025-04-16 |
|
| PDBID: | 8wsa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsi | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease, pH=6.0 | | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsr | | Status: | HPUB -- hold until publication | | Title: | the structure of BtSY1_RBD/hACE2 protein | | Authors: | Xu, Z.P., Sun, J.Q. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wt0 | | Status: | HOLD -- hold until a certain date | | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
