PDBID: | 8rg9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 8rga | Status: | HPUB -- hold until publication | Title: | BmrA E504-25uMATPMg | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | Deposition date: | 2023-12-13 |
|
PDBID: | 8rgb | Status: | HPUB -- hold until publication | Title: | High pH (8.0) nitrite-bound MSOX movie series dataset 5 of the copper nitrite reductase from Bradyrhizobium sp. ORS375 (two-domain)[5.60 MGy] | Authors: | Rose, S.L., Ferroni, F.M., Antonyuk, S.V., Eady, R.R., Hasnain, S.S. | Deposition date: | 2023-12-13 |
|
PDBID: | 8rgc | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 8rgd | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 8rgf | Status: | HPUB -- hold until publication | Title: | Arginase 2 in complex with inhibitor | Authors: | Petersen, J. | Deposition date: | 2023-12-13 |
|
PDBID: | 8rgj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 8rgm | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of nucleosome containing Widom603 DNA | Authors: | Motorin, N.A., Afonin, D., Armeev, G.A., Moiseenko, A., Zhao, L., Vasiliev, V., Oleinikov, P., Shaytan, A., Shi, X., Studitsky, V., Sokolova, O. | Deposition date: | 2023-12-14 |
|
PDBID: | 8rgn | Status: | HPUB -- hold until publication | Title: | BmrA E504-R6G-70uMATPMg | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | Deposition date: | 2023-12-14 |
|
PDBID: | 8rgu | Status: | HPUB -- hold until publication | Title: | Arginase 2 in complex with inhibitor | Authors: | Petersen, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8rgv | Status: | HPUB -- hold until publication | Title: | Myo-inositol-1-phosphate synthase from Thermochaetoides thermophila in complex with NAD | Authors: | Traeger, T.K., Kyrilis, F.L., Hamdi, F., Kastritis, P.L. | Deposition date: | 2023-12-14 |
|
PDBID: | 8rgx | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8rh4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8rh5 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-14 |
|
PDBID: | 8rh7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rh8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rh9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rha | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhb | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhd | Status: | HPUB -- hold until publication | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhg | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhh | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhm | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 | Sequence: | >Entity 1 GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDSFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR
|
|
PDBID: | 8rho | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhp | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|