| PDBID: | 8rby | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.26 | | Authors: | Casasnovas, J.M., Fernandez, L.A., Silva, K. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rc3 | | Status: | HPUB -- hold until publication | | Title: | DNA bound type IV-A1 CRISPR effector complex from P. oleovorans | | Authors: | Miksys, A., Cepaite, R., Malinauskaite, L., Pausch, P. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rc5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rc6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of hexameric BTB domain of Drosophila CG6765 protein | | Authors: | Bonchuk, A.N., Naschberger, A., Baradaran, R. | | Deposition date: | 2023-12-06 | | Sequence: | >Entity 1
AENYHLKWDSHLTYLNSSIATLYKNEKFADVVLYSSYNSSGIPSDIPTVGISAHKFILSASSQFFATMFETAPITNPNGVLYVVLPPDLSHRAIQILVQYMYSGEATVSNDILNEVLRGGEILKIRGLCRT
|
|
| PDBID: | 8rcd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rce | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR alfa Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-06 | | Sequence: | >Entity 1
HHHHHHSSGLVPRGSHTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
|
|
| PDBID: | 8rcf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rch | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of mTORC1 with a paediatric kidney cancer-associated 1455-EWED-1458 duplication in mTOR, overall refinement | | Authors: | Anandapadamanaban, M., Hay, I.M., Perisic, O., Williams, R.L. | | Deposition date: | 2023-12-06 | | Release date: | 2024-12-06 |
|
| PDBID: | 8rci | | Status: | HPUB -- hold until publication | | Title: | Human p53 DNA-binding domain bound to DARPin C10 | | Authors: | Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rck | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of mTORC1 with a paediatric kidney cancer-associated 1455-EWED-1458 duplication in mTOR, Focused on one protomer copy. | | Authors: | Anandapadamanaban, M., Hay, I.M., Perisic, O., Williams, R.L. | | Deposition date: | 2023-12-06 | | Release date: | 2024-12-06 |
|
| PDBID: | 8rcn | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of mTORC1 with a paediatric kidney cancer-associated 1455-EWED-1458 duplication in mTOR, Focused region of mTOR and RAPTOR on one protomer copy. | | Authors: | Anandapadamanaban, M., Hay, I.M., Perisic, O., Williams, R.L. | | Deposition date: | 2023-12-06 | | Release date: | 2024-12-06 |
|
| PDBID: | 8rcr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcx | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of the Mycobacterium tuberculosis regulator VirS (N-terminal fragment 4-208) in complex with the drug candidate alpibectir | | Authors: | Edoo, Z., Frita, R., Grosse, C., Bourotte, M., Moune, M., Antoine, R., Trebosc, V., Schellhorn, B., Dreneau, A., Hofmann, L., Kemmer, C., Lociuro, S., Dale, G.E., Jung, F., Perez-Herran, E., Mendoza, A., Rebollo Lopez, M.J., Ghidelli-Disse, S., Drewes, G., Mathys, V., Soetaert, K., Megalizzi, V., Wintjens, R., Barros Aguirre, D., Remuinan, M.D., Gitzinger, M., Deprez, B., Willand, N., Pieren, M., Baulard, A.R. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rcz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the enoyl-ACP reductase FabV from Pseudomonas aeruginosa with NADH cofactor | | Authors: | Vandebroek, L., Van Olmen, F., Voet, A.R.D., Verwilst, P. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rd3 | | Status: | HPUB -- hold until publication | | Title: | Structure of a yeast protein complex | | Authors: | Barbarin-Bocahu, I., Graille, M. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rd4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rd5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rd9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rdb | | Status: | HPUB -- hold until publication | | Title: | Isopenicillin N synthase N252E variant in complex with Fe and ACV under anaerobic conditions | | Authors: | Stead, A., Rabe, P., Schofield, C.J. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rdc | | Status: | HPUB -- hold until publication | | Title: | Galectin-1 in complex with thiogalactoside derivative | | Authors: | Hakansson, M., Diehl, C., Peterson, K., Zetterberg, F., Nilsson, U. | | Deposition date: | 2023-12-07 |
|
| PDBID: | 8rdd | | Status: | HPUB -- hold until publication | | Title: | Structure of the domain of a yeast protein | | Authors: | Barbarin-Bocahu, I., Graille, M. | | Deposition date: | 2023-12-08 |
|
| PDBID: | 8rde | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-08 | | Release date: | 2024-12-08 |
|
