| PDBID: | 8qr5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qr6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qr7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qr8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qr9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qra | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qrb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qrc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ERK2 in complex with a covalently bound macrocyclic ligand | | Authors: | Gelin, M., Labesse, G. | | Deposition date: | 2023-10-06 |
|
| PDBID: | 8qri | | Status: | HPUB -- hold until publication | | Title: | TRRAP and EP400 in the human Tip60 complex | | Authors: | Li, C., Smirnova, E., Schnitzler, C., Crucifix, C., Concordet, J.P., Brion, A., Poterszman, A., SChultz, P., Papai, G., Ben-Shem, A. | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrj | | Status: | HPUB -- hold until publication | | Title: | LCC-ICCG PETase mutant H218Y | | Authors: | Orr, G., Niv, Y., Barakat, M., Boginya, A., Dessau, M., Afriat-Jurnou, L. | | Deposition date: | 2023-10-09 | | Sequence: | >Entity 1
MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQYAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ
|
|
| PDBID: | 8qro | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qru | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qs2 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 29 (1076409) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs3 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 23 (1083848) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs4 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 22 (1083853) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs5 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs6 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 21 (1075354) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
| PDBID: | 8qs7 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 70 (1084352) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2023-10-10 |
|
