| PDBID: | 8qx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8qx4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8qx6 | | Status: | HPUB -- hold until publication | | Title: | Novel laminarin-binding CBM X584 | | Authors: | Zuehlke, M.K., Jeudy, A., Czjzek, M. | | Deposition date: | 2023-10-22 | | Sequence: | >Entity 1
DFALPINFGADIEYTTGANSVPFEVVTNPEQSGINATDTKVGKVTNQGGQYEALTFLLDEAIDFSGSNKTITMKVYSEVAYQVLFKLETGMNGERANEVEVSHSGNGWEELSFNFNNARNSFVQGDDANNGQPFVPTGQYDEISIFLDFAGFTAGDFYIDDIEQN
|
|
| PDBID: | 8qxg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8qxr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-24 | | Release date: | 2024-10-24 |
|
| PDBID: | 8qxy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qxz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy7 | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD apo form | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qy8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8qyc | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD in complex with ATP-gamma-S | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qyd | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8qyh | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB ZorA E86A_E89A, Calcium binding site mutation | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyk | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB, ZorA delta_359-592, ZorA tail middle deletion. | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyv | | Status: | HOLD -- hold until a certain date | | Title: | SWR1-hexasome complex | | Authors: | Jalal, A.S.B., Wigley, D.B. | | Deposition date: | 2023-10-26 | | Release date: | 2024-10-26 |
|
| PDBID: | 8qyx | | Status: | HPUB -- hold until publication | | Title: | Human 60S ribosomal subunit | | Authors: | Wiechert, F., Schacherl, M., Sprink, T. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyy | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB, ZorA delta_435-729, ZorA tail tip deletion. | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8qyz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-26 | | Release date: | 2024-10-26 |
|
| PDBID: | 8qz0 | | Status: | HOLD -- hold until a certain date | | Title: | SWR1-hexasome-dimer complex | | Authors: | Jalal, A.S.B., Wigley, D.B. | | Deposition date: | 2023-10-26 | | Release date: | 2024-10-26 |
|
| PDBID: | 8qz5 | | Status: | HPUB -- hold until publication | | Title: | Alpha-1-antitrypsin (Tyr244Phe) in the native conformation | | Authors: | Aldobiyan, I., Lomas, D.A., Irving, J.A. | | Deposition date: | 2023-10-26 | | Sequence: | >Entity 1
MRGSHHHHHHTDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQH(OCS)KKLSSWVLLMKFLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
|
|
| PDBID: | 8qz6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-26 |
|
