| PDBID: | 8hj6 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2022-11-22 | | Release date: | 2024-10-22 |
|
| PDBID: | 8hj7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2022-11-22 | | Release date: | 2024-10-22 |
|
| PDBID: | 8hj8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2022-11-22 | | Release date: | 2024-10-22 |
|
| PDBID: | 8hlh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Slack channel pre-open state 2 | | Authors: | Zhang, M.F. | | Deposition date: | 2022-11-30 |
|
| PDBID: | 8hli | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Slack channel pre-open state 1 | | Authors: | Zhang, M.F. | | Deposition date: | 2022-11-30 |
|
| PDBID: | 8hwz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-03 | | Release date: | 2024-07-03 |
|
| PDBID: | 8hx0 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of MsDps2 from Mycobacterium smegmatis | | Authors: | Garg, P., Dutta, S. | | Deposition date: | 2023-01-03 | | Release date: | 2024-07-03 |
|
| PDBID: | 8hx1 | | Status: | HOLD -- hold until a certain date | | Title: | Focused cryo-EM map of MsDps2 from MsDps2-DNA complex of Mycobacterium smegmatis | | Authors: | Dutta, S., Garg, P. | | Deposition date: | 2023-01-03 | | Release date: | 2024-07-03 |
|
| PDBID: | 8hyr | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human KARS apo | | Authors: | Zhang, X., Wang, Y. | | Deposition date: | 2023-01-07 | | Release date: | 2024-07-07 | | Sequence: | >Entity 1
MSVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKELEHHHHHH
|
|
| PDBID: | 8hzv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-09 | | Release date: | 2024-07-09 |
|
| PDBID: | 8hzy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-10 | | Release date: | 2024-07-10 |
|
| PDBID: | 8i0h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Closed conformation of CTPS with dATP dUTP dGTP and DON | | Authors: | Liu, J.L., Guo, C.J. | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-11 |
|
| PDBID: | 8i0i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | dmCTPS with dATP dUTP dGTP and DON | | Authors: | Guo, C.J., Liu, J.L. | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-11 |
|
| PDBID: | 8i0p | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0s | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i0w | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8i37 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-16 | | Release date: | 2024-07-16 |
|
| PDBID: | 8i3v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-18 | | Release date: | 2024-04-18 |
|
| PDBID: | 8i6i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of cyclohexylamine oxidase from Acinetobacter sp. YT-02 | | Authors: | Han, Z., Yan, D. | | Deposition date: | 2023-01-28 | | Release date: | 2024-07-28 |
|
| PDBID: | 8i7s | | Status: | HOLD -- hold until a certain date | | Title: | The crystal structure of human abl1 kinase domain in complex with ABL1-B1 | | Authors: | Zhu, C., Zhang, Z. | | Deposition date: | 2023-02-02 | | Release date: | 2024-08-02 |
|
| PDBID: | 8i7t | | Status: | HOLD -- hold until a certain date | | Title: | The crystal structure of human abl1 kinase domain in complex with ABL1-B4 | | Authors: | Zhu, C., Zhang, Z. | | Deposition date: | 2023-02-02 | | Release date: | 2024-08-02 |
|
