PDBID: | 8yuo | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-03-27 |
|
PDBID: | 8yup | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yuq | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8yur | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8yus | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8yux | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mus musculus IgM hexamer bound to SARS-Cov2-Spike | Authors: | Xin, X., Li, J., Min, L. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yuy | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mus musculus IgM Fab bound to SARS-CoV2-Spike | Authors: | Xin, X., Lin, Y., Li, J., Min, L. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yuz | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Mus musculus IgM pentamer | Authors: | Xin, X., Lin, Y., Li, J., Min, L. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv0 | Status: | HPUB -- hold until publication | Title: | Streptococcus pneumoniae-BceAB-APO-Peptidisc Sample. | Authors: | He, Y.T., Li, J.W., Luo, M. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv1 | Status: | HPUB -- hold until publication | Title: | UPP-bound BceAB in the presence of ATP | Authors: | He, Y.T., Li, J.W., Luo, M. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv2 | Status: | HPUB -- hold until publication | Title: | BceAB dimer with flipped UPP bound | Authors: | He, Y.T., Li, J.W., Luo, M. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv3 | Status: | HPUB -- hold until publication | Title: | The heterotrimer structure of peptides derived from human collagen type I | Authors: | Zhu, Y., Yang, X., Sun, F. | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8yv5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv7 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Thialysine N-epsilon-acetyltransferase from Caenorhabditis elegans | Authors: | Wang, N., Ma, X. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv8 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv9 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-28 | Release date: | 2025-03-28 |
|
PDBID: | 8yva | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-28 | Release date: | 2025-03-28 |
|
PDBID: | 8yvb | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-28 | Release date: | 2025-03-28 |
|
PDBID: | 8yvc | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell:icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 19) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvd | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 16) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yve | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvf | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 | Sequence: | >Entity 1 GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2 MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3 RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
PDBID: | 8yvg | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|