| PDBID: | 8wvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8wvu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8wvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8wvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8wvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8wvy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8wvz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-24 | | Release date: | 2024-10-24 |
|
| PDBID: | 8ww0 | | Status: | HPUB -- hold until publication | | Title: | Cyclic peptide with affinity for ICOS | | Authors: | Fan, S.H., Wu, C.L. | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8ww1 | | Status: | HPUB -- hold until publication | | Title: | Cyclic peptide with affinity for HER3 | | Authors: | Fan, S.H., Wu, C.L. | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8ww3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8ww4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8ww5 | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A C240S | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8ww6 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8ww7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8ww8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8ww9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8wwa | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8wwb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwc | | Status: | HPUB -- hold until publication | | Title: | De novo design binder of HRAS -120-4 | | Authors: | Wang, L., Wang, S., Liu, Y. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of (S)-DHPS dehydrogenase HpsP from Dinoroseobacter shibae DFL 12 | | Authors: | Le, L., Kai, T. | | Deposition date: | 2023-10-25 | | Sequence: | >Entity 1
HHHHHHSSGGMKALVYTGVAQLAFRDVPEPVPAAGDHLIRIDSVGICGSDMHAYLGHDDRRPAPLILGHEGAGVIIGGPRDGERVTINPLVTCGTCPACVSGRDNLCATRQIISMPPRDGAFAQYVAMPARNLVTVPDDVPLEKAALAEPVAVSWHAVRLGLASMADARRDSALVIGGGAIGVAAAISLQAQGVADVTLVEPNAMRREYLARDANYTIATPEQVAGRVFDITVDGVGYDATRAAASAATRPGGLLLHIGLGGGSAGLDIRRITLQEITVIGTYTYTAQDFRDTCAAMFDGRLGGLDWTESRPLSAGADAFADIRAGRVPAPKIILKP
>Entity 2
HHHHHSSGGMKALVYTGVAQLAFRDVPEPVPAAGDHLIRIDSVGICGSDMHAYLGHDDRRPAPLILGHEGAGVIIGGPRDGERVTINPLVTCGTCPACVSGRDNLCATRQIISMPPRDGAFAQYVAMPARNLVTVPDDVPLEKAALAEPVAVSWHAVRLGLASMADARRDSALVIGGGAIGVAAAISLQAQGVADVTLVEPNAMRREYLARDANYTIATPEQVAGRVFDITVDGVGYDATRAAASAATRPGGLLLHIGLGGGSAGLDIRRITLQEITVIGTYTYTAQDFRDTCAAMFDGRLGGLDWTESRPLSAGADAFADIRAGRVPAPKIILKP
>Entity 3
GGMKALVYTGVAQLAFRDVPEPVPAAGDHLIRIDSVGICGSDMHAYLGHDDRRPAPLILGHEGAGVIIGGPRDGERVTINPLVTCGTCPACVSGRDNLCATRQIISMPPRDGAFAQYVAMPARNLVTVPDDVPLEKAALAEPVAVSWHAVRLGLASMADARRDSALVIGGGAIGVAAAISLQAQGVADVTLVEPNAMRREYLARDANYTIATPEQVAGRVFDITVDGVGYDATRAAASAATRPGGLLLHIGLGGGSAGLDIRRITLQEITVIGTYTYTAQDFRDTCAAMFDGRLGGLDWTESRPLSAGADAFADIRAGRVPAPKIILKP
|
|
| PDBID: | 8wwe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of (R)-DHPS dehydrogenase HpsN from Ruegeria pomeroyi DSS-3 | | Authors: | Le, L., Kai, T. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of (R)-DHPS dehydrogenase HpsO from Ruegeria pomeroyi DSS-3 | | Authors: | Le, L., Kai, T. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwg | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 complex with NAD | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8wwi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-25 |
|
