| PDBID: | 8tog | | Status: | HPUB -- hold until publication | | Title: | X-Ray Structure Determination of Dihydromethanopterin Reductase (DmrA) from Methylobacterium extorquens AM1 in a P6522 Space Group at a Resolution of 1.56 Angstroms | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbing, M., Collazo, M.J., Potla, S. | | Deposition date: | 2023-08-03 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8toh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8ton | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-03 | | Release date: | 2024-08-03 |
|
| PDBID: | 8top | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of HIV-1 Env BG505 DS-SOSIP in complex with antibody GPZ6-b.01 targeting the fusion peptide | | Authors: | Zhou, T., Morano, N.C., Roark, R.S., Kwong, P.D. | | Deposition date: | 2023-08-03 |
|
| PDBID: | 8tox | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8toy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8toz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8tp0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8tpu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8tpw | | Status: | HPUB -- hold until publication | | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 3 in complex with antibody fragment 1B2: cis-oriented 1B2 and ACP | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8tpx | | Status: | HPUB -- hold until publication | | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 3 in complex with antibody fragment 1B2: trans-oriented 1B2 and ACP | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8tq1 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 BG505 Env SOSIP in complex with bovine Fab Bess4 and non-human primate Fab RM20A3 | | Authors: | Ozorowski, G., Lee, W.H., Ward, A.B. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8tq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8tq4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tqb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | mGluR3 in the presence of the agonist LY379268 and PAM VU6023326 | | Authors: | Strauss, A., Levitz, J. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8tqc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8tqf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Soybean SHMT8 in complex with PLP-glycine and diglutamylated 5-formyltetrahydrofolate | | Authors: | Owuocha, L.F., Beamer, L.J. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8tqh | | Status: | HPUB -- hold until publication | | Title: | MPI68 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8tqj | | Status: | HPUB -- hold until publication | | Title: | MPI57 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8tql | | Status: | HPUB -- hold until publication | | Title: | MPI54 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8tqn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2024-08-08 |
|
| PDBID: | 8tqq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2024-08-08 |
|
| PDBID: | 8tqr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2024-08-08 |
|
