PDBID: | 8q6n | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-14 |
|
PDBID: | 8q6r | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-14 | Release date: | 2024-08-14 |
|
PDBID: | 8kex | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-14 | Release date: | 2025-02-14 |
|
PDBID: | 8ttq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-14 | Release date: | 2024-12-31 |
|
PDBID: | 8ttr | Status: | HPUB -- hold until publication | Title: | CA9 mimic bound to SH7 | Authors: | Peat, T.S. | Deposition date: | 2023-08-14 |
|
PDBID: | 8q6l | Status: | HPUB -- hold until publication | Title: | human Carbonic Anhydrase I in complex with 3,4-dihydro-1H-benzo[c][1,2]oxaborinin-1-ol | Authors: | Angeli, A., Ferraroni, M. | Deposition date: | 2023-08-13 | Sequence: | >Entity 1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8keu | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ker | Status: | HPUB -- hold until publication | Title: | Structure of SARS-CoV-2 XBB Variant Spike protein complexed with broadly neutralizing antibody PW5-535 | Authors: | Sun, L., Mao, Q., Wang, Y. | Deposition date: | 2023-08-13 |
|
PDBID: | 8kep | Status: | HPUB -- hold until publication | Title: | The local refined map of SARS-CoV-2 Omicron BA.1 Spike complexed with antibody PW5-570 | Authors: | Sun, L., Mao, Q., Wang, Y. | Deposition date: | 2023-08-13 |
|
PDBID: | 8keo | Status: | HPUB -- hold until publication | Title: | Structure of SARS-CoV-2 Omicron BA.1 Spike complexed with antibody PW5-570 | Authors: | Sun, L., Mao, Q., Wang, Y. | Deposition date: | 2023-08-13 |
|
PDBID: | 8keq | Status: | HPUB -- hold until publication | Title: | State 1 of SARS-CoV-2 XBB Variant Spike protein trimer complexed with antibody PW5-5 | Authors: | Sun, L., Mao, Q., Wang, Y. | Deposition date: | 2023-08-13 |
|
PDBID: | 8ket | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human complex A | Authors: | Qian, H.W., He, J.J. | Deposition date: | 2023-08-13 | Release date: | 2025-02-13 |
|
PDBID: | 8kes | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-13 | Release date: | 2025-02-13 |
|
PDBID: | 8kev | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-13 | Release date: | 2025-02-13 |
|
PDBID: | 8kew | Status: | HPUB -- hold until publication | Title: | The cryo-EM structure of type1 amyloid beta 42 fibril. | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | Deposition date: | 2023-08-13 |
|
PDBID: | 8tt8 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 |
|
PDBID: | 8tt9 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 | Sequence: | >Entity 1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
PDBID: | 8tta | Status: | HOLD -- hold until a certain date | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 21 (1328-1341) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ttc | Status: | HOLD -- hold until a certain date | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 20 (1289-1302) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ttd | Status: | HOLD -- hold until a certain date | Title: | Structure of VPS29 complexed with Fam21A repeat 21 (1328-1341) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8ken | Status: | HPUB -- hold until publication | Title: | Structure of DexA reveal the novel mechanism of DNA catalysis | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | Deposition date: | 2023-08-12 |
|
PDBID: | 8kel | Status: | HPUB -- hold until publication | Title: | Structure of DexA reveal the novel Mechanism of DNA catalysis | Authors: | Liu, Y.H., Ma, B., Kang, Y., Liu, B., Li, Y. | Deposition date: | 2023-08-12 |
|
PDBID: | 8q67 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 |
|
PDBID: | 8q69 | Status: | HPUB -- hold until publication | Title: | Crystal structure of HsRNMT complexed with inhibitor DDD1060606 | Authors: | Petit, A.P., Fyfe, P.K. | Deposition date: | 2023-08-11 |
|
PDBID: | 8q6d | Status: | HPUB -- hold until publication | Title: | Anaerobic crystal structure of HIF prolyl hydroxylase 2 (PHD2 181-407) in complex with HIF2alpha-CODD peptide (523-542), Fe(II) and 2-oxoglutarate (2OG) | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | Deposition date: | 2023-08-11 |
|