| PDBID: | 9lgc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lge | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Bcl-xL in complex with stapled HRK peptide | | Authors: | Wei, H., Guo, M., Wang, J. | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of a designed AAV2-based vector | | Authors: | Luo, S., Ke, X., Zheng, Q. | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human PKMYT1 protein kinase domain with Naphthyridinone Inhibitor compound 40 | | Authors: | Xu, Z.H., Chen, S. | | Deposition date: | 2025-01-10 | | Sequence: | >Entity 1
ALQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQ
|
|
| PDBID: | 9lgv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human PKMYT1 protein kinase domain with Naphthyridinone Inhibitor compound 11 | | Authors: | Xu, Z.H., Chen, S. | | Deposition date: | 2025-01-10 | | Sequence: | >Entity 1
HQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEAWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLGDFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATAEALLALPVLRQP
|
|
| PDBID: | 9lgl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human PKMYT1 protein kinase domain with Naphthyridinone Inhibitor compound 6 | | Authors: | Xu, Z.H., Chen, S. | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgs | | Status: | HPUB -- hold until publication | | Title: | R-degron fused ZZ-domain of the Arabidopsis thaliana E3 ubiquitin-protein ligase BIG | | Authors: | Yang, W.S., Lee, J., Song, H.K. | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgr | | Status: | HPUB -- hold until publication | | Title: | Y-degron fused ZZ-domain of the Arabidopsis thaliana E3 ubiquitin-protein ligase BIG | | Authors: | Yang, W.S., Lee, J., Song, H.K. | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9lgp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the HRV B14 3C protease in complex with AG7404 | | Authors: | Lee, J., Kim, H., Jo, I. | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9hym | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of WT E.coli ribosome with complexed filament nascent chain at length 34, with mRNA, P-site and A-site tRNAs, and mRNA | | Authors: | Mitropoulou, A., Wlodarski, T., Plessa, E., Cabrita, L.D., Christodoulou, J. | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9hyi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-10 |
|
| PDBID: | 9hys | | Status: | HOLD -- hold until a certain date | | Title: | Structure of METTL21A (K215A mutant) bound to compound 5 | | Authors: | Peng, L., Metzger, E., Schuele, R. | | Deposition date: | 2025-01-10 | | Release date: | 2026-01-10 |
|
| PDBID: | 9hyu | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of PSI super complex from C. velia | | Authors: | Yuan, X., Qian, P., Sobotka, R., Naschberger, A. | | Deposition date: | 2025-01-10 | | Release date: | 2026-01-10 |
|
