| PDBID: | 9k0d | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 1 | | Authors: | Xia, W.C., Sun, Y.P., Liu, C. | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9k0e | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 2 | | Authors: | Xia, W.C., Sun, Y.P., Liu, C. | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9k0f | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Amyloid-beta42-4b polymorph 3 | | Authors: | Xia, W.C., Sun, Y.P., Liu, C. | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9k0j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k0i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k0m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9jzy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pyrococcus horikoshii AIR synthetase | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k02 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Pyrococcus abyssi AIR synthetase bound to ADP and Mg(II) | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9jzi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9jzz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pyrococcus horikoshii AIR synthetase bound to AMP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9k08 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-15 | | Sequence: | >Entity 1
KLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGARPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTD
>Entity 2
(ACE)(DAR)(DLY)(DTY)(DTY)G(0QE)
|
|
| PDBID: | 9k0l | | Status: | HPUB -- hold until publication | | Title: | crystal structure Rtks of F222 | | Authors: | Xu, M., Ran, T., Wang, W. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9dz4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9dz3 | | Status: | HPUB -- hold until publication | | Title: | Photoactivation in Bacteriophytochromes, reference (dark) structure for the 3 ps time point | | Authors: | Malla, T.N., Stojkovic, E.A., Schmidt, M. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9dz7 | | Status: | HPUB -- hold until publication | | Title: | Structure of ALAS bound to glycine from S. cerevisiae | | Authors: | Tran, J.U., Brown, B.L. | | Deposition date: | 2024-10-15 | | Sequence: | >Entity 1
AAAAANHSTQESGFDYEGLIDSELQKKRLDKSYRYFNNINRLAKEFPLAHRQREADKVTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKMKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPKSVPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFESHRASGIATPKTNDKGGAKTVMDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIVPVLIGNADLAKQASDILINKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQLPRVRDWESQGGLLGVGESGFVEESNLWTSSQLSLTNDDLNPNVRDPIVKQLEVSSGIKQ
|
|
| PDBID: | 9dzb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-15 | | Release date: | 2025-10-15 |
|
| PDBID: | 9dz9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9dza | | Status: | HPUB -- hold until publication | | Title: | Photoactivation in Bacteriophytochrome, high resolution cryo structure in the dark. | | Authors: | Malla, T.N., Stojkovic, E.A., Schmidt, M. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9h30 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9h2s | | Status: | HPUB -- hold until publication | | Title: | a YnaI-MscS chimera in a closed conformation purified in DDM with additional lipids showing ligand-filled pore and pockets | | Authors: | Flegler, V.J., Bottcher, B., Rasmussen, T., Rasmussen, A., Hedrich, R. | | Deposition date: | 2024-10-15 |
|
| PDBID: | 9h2v | | Status: | HPUB -- hold until publication | | Title: | a YnaI-MscS chimera in an open conformation purified in DDM showing ligand-filled pockets | | Authors: | Flegler, V.J., Bottcher, B., Rasmussen, T., Rasmussen, A., Hedrich, R. | | Deposition date: | 2024-10-15 |
|
