PDBID: | 9e2f | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of a di-nucleosome with a five base pair linker | Authors: | Xie, X., Liu, M., Zhou, X.E., Worden, E., Jones, P. | Deposition date: | 2024-10-22 |
|
PDBID: | 9e2r | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human DNMT3A2-DNMT3B3 complex bound to a di-nucleosome and an histone-3 peptide | Authors: | Xie, X., Liu, M., Zhou, X.E., Worden, E., Jones, P. | Deposition date: | 2024-10-22 |
|
PDBID: | 9e2q | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of DNMT 3A2/3B3 tetramer in complex with a di-nucleosome with a six base pair linker | Authors: | Xie, X., Liu, M., Zhou, X.E., Worden, E., Jones, P. | Deposition date: | 2024-10-22 |
|
PDBID: | 9e2s | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-22 |
|
PDBID: | 9e2t | Status: | HOLD -- hold until a certain date | Title: | Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg | Authors: | Abhiraman, G.C., Jude, K.M., Garcia, K.C. | Deposition date: | 2024-10-22 | Release date: | 2025-10-22 |
|
PDBID: | 9h57 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of human mitochondrial ribosome small subunit bound to METTL15 and mS37 (State A7*) | Authors: | Khawaja, A., Singh, V., Shiriaev, D.I., Rorbach, J. | Deposition date: | 2024-10-22 |
|
PDBID: | 9h5l | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-22 | Sequence: | >Entity 1 SALSLRINANDGRARQCTLTLPHGEVETPVFMPVGTNASVNSLTYEQVNEMGCQILLANTYHMFLHPGVDVLNNAGGLHQFANWDGNILTDSGGFQMVSLSDTMTVNEQGVIFQSIVDHNPINLPPEESIHIQQAIGSDIMMQLDDVVSSLTTGPRVEEAMERSVRWLARCNNEYLNTNENQNLFGIIQGGLQPNLRERCLEGMVNVDTPGYAIGGLSGGEANDDFWNMVDISAQGLPENNPRYLMGVGYPVEMLLCVLFGVDMFDCVYPTRTARFGTAFSDDGLVTLNINNYNDDFNVIDESCDCLCCNNGNGLTNSALHFMFTNGAVDGTPVAQYLTHHNISYLFNLMRNYRVAIREGNSNTFARDYIIRFYGGNEHVPQWIIDALTNVGVEF
>Entity 2 MADLMSTSTPQFQIISTTKVGSIPFVTIDNYEKYLKEVNTFLFCYRDLYEAQEFILKYGKGYKKYFMMPEQSHHILSMSLTEKIDDSCNKLTKAEFNITTRGGYRPLTIQQVINFSNQSGFDKIEGFCYSPLEKRKTSKKMKQQRQIVIKKLKEMIEEKTKKGLTIEIIASIGLTGLDDDIQYVKDIIQTGIHEIVFDCEYIEDKDKILDFIQNIKDLCNNIKMYVKLYSFNLSQIIQAALMNVSIWTNSINEFTLHGQAFVFPLSINQNNNITSIDLYNTCYKDVVNDVCVNGCECFSCKSNQSRAYIHHLLLCHELTGTTLLSLHNFHYIHKLEQLINSLLLNDRSKLQQLADFYNSLIPPPEFQKVKLYADHRTKENEDDD
>Entity 3 CUUCAAUAGUAUAGCUGGUUAGUAUCUUCGCCUGUCACGUGAAAGACCGGGGUUCGAAUCCCCGUUGAAGACCAC
|
|
PDBID: | 9k4a | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-21 |
|
PDBID: | 9k4b | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-21 |
|
PDBID: | 9k4j | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state EA1.0 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k4k | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state EA1.1 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k4l | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged 26S proteasome RP-CP subcomplex in state EA1.2 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k4m | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state EA2.1 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k4o | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state EA2.2 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k50 | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state ED1.2 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k51 | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state ED1.3 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k53 | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state ED2.1 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k54 | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state ED2.2 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k55 | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state ED2.3 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k56 | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged single-cap human proteasome in state EA1 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k57 | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged single-cap human proteasome in state EA2 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k58 | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged single-cap human proteasome in state EB | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k59 | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged single-cap human proteasome in state EC1 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k5a | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged single-cap human proteasome in state EC2 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|
PDBID: | 9k5b | Status: | HPUB -- hold until publication | Title: | Structure of substrate-engaged single-cap human proteasome in state ED0 | Authors: | Wu, Z., Chen, E., Mao, Y. | Deposition date: | 2024-10-21 |
|