| PDBID: | 9e8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9e8r | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease T190I covalently bound to compound GRL-051-22 at 1.5 A | | Authors: | Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-11-06 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQIAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9e8t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9hbc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-06 |
|
| PDBID: | 9keo | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of HdNadV and its complex with NAM | | Authors: | Lin, T., ZhengJuan, W., Jia, Y. | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kex | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kem | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-05 | | Release date: | 2025-11-05 |
|
| PDBID: | 9kf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kfa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf3 | | Status: | PROC -- to be processed | | Title: | Crystal structure of Streptomyces sp. sulfotransferase Cpz8 in complex with PAP and Presulficidin-analog, involved in Caprazamycins synthesis | | Authors: | Iwamoto, Y., Watanabe, M., Suzuki, K., Teramoto, T., Kakuta, Y. | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the reaction intermediate of Streptomyces sp. sulfotransferase Cpz4 involved in caprazamycins synthesis | | Authors: | Iwamoto, Y., Watanabe, M., Suzuki, K., Teramoto, T., Kakuta, Y. | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kej | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9ken | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of TRIP12 in complex with K29/48 branched-triUb | | Authors: | Ai, H.S., Wu, X.W., Liu, L. | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9keg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 | | Sequence: | >Entity 1
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMLEHHHHHH
|
|
| PDBID: | 9keh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 | | Sequence: | >Entity 1
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMLEHHHHHH
|
|
