PDBID: | 9f0v | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-17 |
|
PDBID: | 9f0o | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-17 | Release date: | 2025-10-17 |
|
PDBID: | 9f0w | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-17 | Release date: | 2025-10-17 |
|
PDBID: | 9bep | Status: | HPUB -- hold until publication | Title: | Structure of S1_8C, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 9bes | Status: | HPUB -- hold until publication | Title: | Structure of S1_8A, a lambda-carrageenan specific sulfatase, in complex with monosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 9beu | Status: | HPUB -- hold until publication | Title: | Structure of GH110B in complex with a lambda-carrageenan oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 9bev | Status: | HPUB -- hold until publication | Title: | Structure of GH110A in complex with a lambda-carrageenan oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 9bey | Status: | HPUB -- hold until publication | Title: | Structure of a lambda-carrageenan active GH2 A in complex with inhibitor | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-16 |
|
PDBID: | 8z3t | Status: | HPUB -- hold until publication | Title: | Structure of P-98/N44 | Authors: | Liu, N., Qin, B. | Deposition date: | 2024-04-16 | Release date: | 2025-10-16 |
|
PDBID: | 9be9 | Status: | HPUB -- hold until publication | Title: | HIV-1 Env 16055 dGly4 NFL | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | Deposition date: | 2024-04-15 | Release date: | 2025-10-14 |
|
PDBID: | 9bef | Status: | HPUB -- hold until publication | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9beh | Status: | HPUB -- hold until publication | Title: | Structure of GH110A in complex with galactose-6-sulfate | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9f0d | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 | Release date: | 2025-10-15 |
|
PDBID: | 9f03 | Status: | AUTH -- processed, waiting for author review and approval | Title: | mRhubarb720-WT | Authors: | Aksakal, O., Rizkallah, P.J., Warren, A., Lipka-Lloyd, M., Jones, D.D. | Deposition date: | 2024-04-15 | Release date: | 2025-10-15 |
|
PDBID: | 9ezr | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | XFEL structure of hNQO1 mixed with NADH in an extended orientation at 0.3 s | Authors: | Grieco, A., Quereda-Moraleda, I., Botha, S., Martin-Garcia, J.M. | Deposition date: | 2024-04-14 |
|
PDBID: | 9ezu | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 | Release date: | 2025-10-14 |
|
PDBID: | 9ezv | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 | Release date: | 2025-10-14 |
|
PDBID: | 9ezw | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 | Release date: | 2025-10-14 |
|
PDBID: | 9bdm | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-12 | Release date: | 2025-10-11 |
|
PDBID: | 9bdr | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM structure of cardiac amyloid fibril from a variant ATTRV122delta, double filament morphology 1 | Authors: | Nguyen, B.A., Ahmed, Y., Saelices, L. | Deposition date: | 2024-04-12 | Release date: | 2025-10-11 |
|
PDBID: | 8z1u | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-12 | Release date: | 2025-10-12 |
|
PDBID: | 9ezh | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 | Release date: | 2025-10-12 |
|
PDBID: | 9ezi | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-12 | Release date: | 2025-10-12 |
|
PDBID: | 9bda | Status: | HPUB -- hold until publication | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | Authors: | Schormann, N., Green, T., Turnbough, C.L. | Deposition date: | 2024-04-11 | Release date: | 2025-10-10 | Sequence: | >Entity 1 MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2 AFDPNLVGPTLPPIPPFTL
|
|
PDBID: | 9bdb | Status: | HPUB -- hold until publication | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | Authors: | Schormann, N., Green, T., Turnbough, C.L. | Deposition date: | 2024-04-11 | Release date: | 2025-10-10 | Sequence: | >Entity 1 MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2 AFDPNLVGPTLPPIPPFTL
|
|