| PDBID: | 9fun | | Status: | HPUB -- hold until publication | | Title: | Succinyl-CoA:(R)-benzylsuccinate CoA-transferase (BbsEF) + CoA + benzylsuccinate (weakly occupied) | | Authors: | Ermler, U., Heider, J., Demmer, U. | | Deposition date: | 2024-06-26 | | Release date: | 2025-12-26 |
|
| PDBID: | 9fuf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-26 | | Release date: | 2025-12-26 |
|
| PDBID: | 9fu5 | | Status: | HPUB -- hold until publication | | Title: | 25-hydroxy steroid kinase + AMP | | Authors: | Ermler, U., Boll, M., Demmer, U., Warkentin, E., Jacoby, C. | | Deposition date: | 2024-06-26 | | Release date: | 2025-12-26 |
|
| PDBID: | 9ijr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 | | Release date: | 2025-12-25 |
|
| PDBID: | 9ijs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 | | Release date: | 2025-12-25 |
|
| PDBID: | 9ijx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mouse Spef1 coiled-coil domain | | Authors: | Ren, J., Li, D., Feng, W. | | Deposition date: | 2024-06-25 | | Sequence: | >Entity 1
GPGSYNQALQGDPSFVLQIAEKEQELLASQETVQVLQMKVKRLEHLLQLKNVRIDDLSRRLQQAERKQR
|
|
| PDBID: | 9cdq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 | | Release date: | 2025-12-24 |
|
| PDBID: | 9cds | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OspA ST1 from B. burgdorferi bound to monoclonal antibody LA-2 | | Authors: | Laciak, A.R., Lai, Y.-T., Dhingra, Y. | | Deposition date: | 2024-06-25 | | Release date: | 2025-09-24 |
|
| PDBID: | 9cdn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 | | Release date: | 2025-12-24 |
|
| PDBID: | 9ftp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 | | Release date: | 2025-12-25 |
|
| PDBID: | 9cd3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 |
|
| PDBID: | 9cd4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 |
|
| PDBID: | 9cd6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 | | Release date: | 2025-12-23 |
|
| PDBID: | 9cd8 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Acetyl-CoA synthetase from Cryptococcus neoformans H99 in complex with inhibitor HGN-1310 (dd3-027) | | Authors: | Seattle Structural Genomics Center for Infectious Disease, Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2024-06-24 | | Release date: | 2025-12-23 |
|
| PDBID: | 9fte | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 | | Release date: | 2025-12-24 |
|
| PDBID: | 9ft6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 | | Release date: | 2025-12-24 |
|
| PDBID: | 9ft5 | | Status: | HPUB -- hold until publication | | Title: | 25-hydroxy steroid kinase (25-HSK) + ADP + 25-phospho-cholest-1,4-diene-3-one | | Authors: | Ermler, U., Boll, M., Demmer, U., Warkentin, E., Jacoby, C. | | Deposition date: | 2024-06-24 | | Release date: | 2025-12-24 |
|
| PDBID: | 9ft4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 | | Release date: | 2025-12-24 |
|
| PDBID: | 9ft3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 | | Release date: | 2025-12-24 |
|
| PDBID: | 9ft2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 | | Release date: | 2025-12-24 |
|
| PDBID: | 9ftk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trans-o-hydroxybenzylidenepyruvate hydratase-aldolase from Pseudomonas fluorescens N3 bound to substrate intermediate | | Authors: | Milani, M., Ferrara, S. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 9ij7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-21 | | Release date: | 2025-09-21 |
|
| PDBID: | 9ij8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-21 | | Release date: | 2025-09-21 |
|
| PDBID: | 9cca | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-21 | | Release date: | 2025-09-20 |
|
| PDBID: | 9ccg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-21 | | Release date: | 2025-12-20 |
|
