PDBID: | 9e65 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-29 |
|
PDBID: | 9l2m | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-17 |
|
PDBID: | 9e66 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of mechanosensitive channel YnaI A155V mutant in conformation 2 | Authors: | Hiotis, G., Will, N., Walz, T. | Deposition date: | 2024-10-29 |
|
PDBID: | 9qv8 | Status: | HPUB -- hold until publication | Title: | Polyester Hydrolase Leipzig 7 (PHL7) variant R2M2-A186S | Authors: | Useini, A., Strater, N., Kuenze, G., Sonnendecker, C. | Deposition date: | 2025-04-11 |
|
PDBID: | 9e68 | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-29 |
|
PDBID: | 9l2n | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-17 |
|
PDBID: | 9qvi | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-11 |
|
PDBID: | 9e61 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Saccharomyces cerevisiae Pmt4 apo form | Authors: | Du, M., Yuan, Z., Li, H. | Deposition date: | 2024-10-29 |
|
PDBID: | 9l2u | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-17 |
|
PDBID: | 9qux | Status: | HPUB -- hold until publication | Title: | Solution structure of the Homer1 EVH1 domain | Authors: | Czajlik, A., Maruzs, B., Fanni, F., Batta, G., Gaspari, Z., Peterfia, B.F. | Deposition date: | 2025-04-11 | Sequence: | >Entity 1 GSHMGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQ
|
|
PDBID: | 9e6e | Status: | HPUB -- hold until publication | Title: | Yeast Fzf1 Zn-fingers 1-3 bound to YHB1 26 bp DNA | Authors: | Moore, S.A., Ma, C., Xiao, W. | Deposition date: | 2024-10-29 |
|
PDBID: | 9l2o | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure and rational engineering of a novel efficient ochratoxin A-detoxifying amidohydrolase | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | Deposition date: | 2024-12-17 |
|
PDBID: | 9qur | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-11 |
|
PDBID: | 9e6f | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-30 |
|
PDBID: | 9l2p | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-17 | Sequence: | >Entity 1 MTGIPTVTARPWTQRPRAENSTTNPTYFFTFGDAYSQTGFSASGTQPSASNPMGNPDLGIGTTTNGPNWIGYLTTTENASLVLSYNLAAGGATIDNALVPAYPGDLASQFRLFEDVYADKPASAPWSAEDAVFGVWIGINDIGNAYYSTDAETYTPKLISRLESLVEEVYKNGGRKFLFLNVPPTSRSPLFLEQGEEVVKQHAEYLSVYNENLEGMVDDFTKKKGDVTTVLYDSWSFMTKILDDPTAYGFPDATCINDDGTSCIWWNNYHPGMKYHLLQAEDMKPKLRKLGGW
|
|
PDBID: | 9e6p | Status: | HPUB -- hold until publication | Title: | Structure of a Mouse KC dimeric mutant | Authors: | White, M.A., Sepuru, K.M., Rajarathnam, K. | Deposition date: | 2024-10-30 |
|
PDBID: | 9l38 | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-17 |
|
PDBID: | 9e6o | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-30 |
|
PDBID: | 9l2t | Status: | HPUB -- hold until publication | Title: | Cryo-electron microscopic structure of a novel amidohydrolase with three mutations | Authors: | Dai, L.H., Xu, Y.H., Hu, Y.M., He, B.Y., Huang, J.P., Xie, Z.Z., Li, H., Niu, D., Guo, R.-T., Chen, C.-C. | Deposition date: | 2024-12-17 |
|
PDBID: | 9e6i | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Saccharomyces cerevisiae Pmt4-Ccw5 complex | Authors: | Du, M., Yuan, Z., Li, H. | Deposition date: | 2024-10-30 |
|
PDBID: | 9l34 | Status: | HPUB -- hold until publication | Deposition date: | 2024-12-17 |
|
PDBID: | 9qv1 | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-11 |
|
PDBID: | 9quq | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-11 |
|
PDBID: | 9e6j | Status: | HPUB -- hold until publication | Deposition date: | 2024-10-30 |
|
PDBID: | 9qv3 | Status: | HPUB -- hold until publication | Deposition date: | 2025-04-11 |
|