Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 12798 results
PDBID:9ga9
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure hASF1A 156-cr7
Authors:Ochsenbein, F.O., Vitard, A.V.
Deposition date:2024-07-26
PDBID:9ga1
Status:HPUB -- hold until publication
Deposition date:2024-07-26
PDBID:9ga6
Status:AUTH -- processed, waiting for author review and approval
Title:The crystal structure of human Annexin A4 derived from crystals grown in 40 mM of CaCl2
Authors:Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Bifulco, G., Campiglia, P., Sala, M., Scala, M.C., Ruggiero, A.
Deposition date:2024-07-26
PDBID:9ga7
Status:AUTH -- processed, waiting for author review and approval
Title:The crystal structure of human Annexin A4 derived from crystal grown at 4 mM CaCl2 and retro-soaking
Authors:Vitagliano, L., Barra, G., Ghilardi, O., Di Micco, S., Scala, M.C., Sala, M., Campiglia, P., Bifulco, G., Ruggiero, A.
Deposition date:2024-07-26
PDBID:9ga8
Status:AUTH -- processed, waiting for author review and approval
Title:The crystal structure of human Annexin A4 from crystals grown at 4 mM Calcium
Authors:Ruggiero, A., Barra, G., Ghilardi, O., Scala, M.C., Sala, M., Di Micco, S., Bifulco, G., Campiglia, P., Vitagliano, L.
Deposition date:2024-07-26
PDBID:9ga2
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-07-26
PDBID:9ga3
Status:AUTH -- processed, waiting for author review and approval
Title:MtUvrA2UvrB bound to damaged oligonucleotide
Authors:Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R.
Deposition date:2024-07-26
PDBID:9ga4
Status:AUTH -- processed, waiting for author review and approval
Deposition date:2024-07-26
PDBID:9ga5
Status:AUTH -- processed, waiting for author review and approval
Title:MtUvrA2 bound to endogenous E. coli DNA
Authors:Genta, M., Capelli, R., Ferrara, G., Rizzi, M., Rossi, F., Jeruzalmi, D., Bolognesi, M., Chaves-Sanjuan, A., Miggiano, R.
Deposition date:2024-07-26
PDBID:9ga0
Status:AUTH -- processed, waiting for author review and approval
Title:XPA crystal grown in HEK293 cell
Authors:Melicher, F., Isabet, T., Chavas, L.M.G., Montaville, P.
Deposition date:2024-07-26
PDBID:9gae
Status:AUTH -- processed, waiting for author review and approval
Title:Respiratory supercomplex CI1-CIII2-CIV2 from alphaproteobacterium
Authors:Yaikhomba, M., Hirst, J., Croll, T.I., Spikes, T.E.
Deposition date:2024-07-26
Release date:2025-07-26
PDBID:9iww
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the mouse RIP3 kinase domain in complexed with GSK''872
Authors:Xie, H., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-07-26
PDBID:9iwx
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the mouse RIP3 kinase domain(R69H) in complexed with GSK''872
Authors:Xie, H., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-07-26
PDBID:9iwy
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the mouse RIP3 kinase domain in complexed with LK01003
Authors:Xie, H., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-07-26
PDBID:9iwz
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the mouse RIP3 kinase domain in complexed with GSK''843
Authors:Xie, H., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-07-26
PDBID:9ix0
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the mouse RIP3 kinase domain in complexed with GW''39B
Authors:Xie, H., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-07-26
PDBID:9ix1
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the mouse RIP3 kinase domain in complexed with PP2
Authors:Xie, H., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-07-26
PDBID:9ix2
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the mouse RIP3 kinase domain in complexed with TAK-632
Authors:Xie, H., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-07-26
PDBID:9ix3
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the mouse RIP3 kinase domain in complexed with compound 18
Authors:Xie, H., Su, H.X., Li, M.J., Xu, Y.C.
Deposition date:2024-07-26
PDBID:9ix9
Status:AUTH -- processed, waiting for author review and approval
Title:Mutant H286T Crystal Structure of Two-domain bacterial laccase from the actinobacterium Streptomyces carpinensis VKM Ac-1300
Authors:Gabdulkhakov, A.G., Tishchenko, T.V., Trubitsina, L., Trubitsin, I., Leontievsky, A., Lisov, A.
Deposition date:2024-07-26
PDBID:9ix8
Status:HPUB -- hold until publication
Title:Crystallization and structural characterization of phosphopentomutase from the hyperthermophilic archaeon Thermococcus kodakarensis
Authors:Naz, Z., Lubkowski, T.J., Saleem, M., Rahman, M., Wlodawer, A., Rashid, N.
Deposition date:2024-07-26
Sequence:

>Entity 1


RLFGTAGIRGTLWEKVTPELAMKVGMAVGTYKSGKALVGRDGRTSSVMLKNAMISGLLSTGMEVLDADLIPTPALAWGTRKLADAGVMITASHNPPTDNGVKVFNGDGTEFYVEQERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHETNLKVLYDGANGAGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQDGDADRIAVFDEKGNYVDEDTVIALFAKLYVEEHGGGTVVVSIDTGSRIDAVVERAGGRVVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWIDPFVTMGLLIKLIDENGPLSELVKEIPTYYLKKANVLCPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGFRIALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDELFEMAYSTVSRIVKEAEKK
PDBID:9iwv
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of Lsd18 after incubation with the substrate
Authors:Wang, Q., Chen, X., Kim, C.Y.
Deposition date:2024-07-26
PDBID:9ix4
Status:REPL -- author sent new coordinates, entry to be reprocessed
Deposition date:2024-07-26
PDBID:9ix5
Status:HPUB -- hold until publication
Title:An agonist(compound 15n) of Thyroid Hormone Receptor B
Authors:Yao, B., Li, Y.
Deposition date:2024-07-26
PDBID:9iwu
Status:HPUB -- hold until publication
Title:CTB10_M40BpA_M86I-R-1d
Authors:Fu, K., Rao, Y.J.
Deposition date:2024-07-26

223790

PDB entries from 2024-08-14

PDB statisticsPDBj update infoContact PDBjnumon