PDBID: | 9rk0 | Status: | HPUB -- hold until publication | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjc | Status: | HPUB -- hold until publication | Title: | Apo Structure of the Human Signal Peptidase | Authors: | Liaci, A.M., Vismpas, D., Skalidis, I., Koh, F.A., Abhay, K., Forster, G.F. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rk2 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of ScV-L-A virus | Authors: | Novoa, G., Gil-Cantero, D., Caston, J.R. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjh | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin-derivative KV26a (compound 4) | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rji | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin-derivative KV29a (compound 5) | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjj | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative KV37a (compound 9) | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjk | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative KV41a (compound 11) | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjl | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative KV35a (compound 12) | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rj4 | Status: | HPUB -- hold until publication | Deposition date: | 2025-06-12 | Sequence: | >Entity 1 GPGMSSLGTVDAPNFIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEFQLGSKLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCET(SEP)GFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRSRK
|
|
PDBID: | 9rje | Status: | HPUB -- hold until publication | Title: | X-ray structure of Chlamydomonas reinhardtii Histone Deacetylase 11 (HDAC11) in complex with hexanoic acid | Authors: | Novakova, Z., Schenkmayerova, A., Motlova, L., Barinka, C. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rj2 | Status: | HPUB -- hold until publication | Deposition date: | 2025-06-12 | Sequence: | >Entity 1 GPGMSSLGTVDAPNFIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEFQLGSKLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCET(SEP)GFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRSRK
|
|
PDBID: | 9rjm | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative EP196 (compound 13) | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjn | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative KV32a (compound 14) | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjd | Status: | HPUB -- hold until publication | Title: | X-ray structure of Leptospira interrogans Histone deacetylase 11 (HDAC11) in complex with Dodec-4-enoic acid | Authors: | Novakova, Z., Schenkmayerova, A., Motlova, L., Barinka, C. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjp | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative KV25a (compound 15) | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rj9 | Status: | HPUB -- hold until publication | Deposition date: | 2025-06-12 |
|
PDBID: | 9rj6 | Status: | HPUB -- hold until publication | Title: | Zn Finger DNA complex | Authors: | Yao, Y.M., OHagan, M.P., Onoon, K., Givon, L., Rogotner-Hamer, S., Kessler, N., Dym, O., Pipatpolkai, T., Schumacher, M.A., Afek, A. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjo | Status: | HPUB -- hold until publication | Title: | [FeFe]-hydrogenase CpI from Clostridium pasteurianum, variant N160L-Q195L | Authors: | Duan, J., Liu, L., Hofmann, E., Happe, T. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjq | Status: | HPUB -- hold until publication | Title: | [FeFe]-hydrogenase CpI from Clostridium pasteurianum, variant Q195L | Authors: | Duan, J., Liu, L., Hofmann, E., Happe, T. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rk3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Soluble domain of kustd1480, a Rieske iron-sulfur cluster protein from Kuenenia stuttgartiensis | Authors: | Hauser, D., Barends, T. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rk4 | Status: | HPUB -- hold until publication | Title: | Soluble domain of kuste4569, a Rieske iron-sulfur cluster protein from Kuenenia stuttgartiensis | Authors: | Hauser, D., Barends, T. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjt | Status: | HPUB -- hold until publication | Deposition date: | 2025-06-12 |
|
PDBID: | 9rjb | Status: | HPUB -- hold until publication | Title: | Human Signal Peptidase in complex with artificial Signal Peptide L11 | Authors: | Liaci, A.M., Vismpas, D., Skalidis, I., Koh, F.A., Abhay, K., Forster, G.F. | Deposition date: | 2025-06-12 |
|
PDBID: | 9rja | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2025-06-12 |
|
PDBID: | 9p25 | Status: | HPUB -- hold until publication | Title: | Crystal structure of ProGH158 at 0.89 angstrom resolution | Authors: | Spadeto, J.P.M., Martins, M.P., Araujo, E.A., Mandelli, F., Domingues, M.N., Morais, M.A.B., Murakami, M.T. | Deposition date: | 2025-06-11 |
|