| PDBID: | 8wjw | | Status: | HPUB -- hold until publication | | Title: | Aldo-keto reductase KmAKR-W297H/Y296W | | Authors: | Xu, S.Y., Zhou, L., Xu, Y., Wang, Y.J., Zheng, Y.G. | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9bs0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-12 |
|
| PDBID: | 8wk2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-F419Y+Y13287 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-26 |
|
| PDBID: | 9bs2 | | Status: | HPUB -- hold until publication | | Title: | Glycosylase MutY variant R149Q in complex with DNA containing d(8-oxo-G) paired with a product analog (THF) to 1.51 A resolution | | Authors: | Trasvina-Arenas, C.H., Tamayo, N., Lin, W.J., Demir, M., Fisher, A.J., David, S.S., Horvath, M.P. | | Deposition date: | 2024-05-12 | | Sequence: | >Entity 1
GSHMTRETERFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMQVLSRLFLVTDDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEPIVSFEHAFSHLVWQLTVFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWASGVRPPP
>Entity 2
(DA)(DA)(DG)(DA)(DC)(8OG)(DT)(DG)(DG)(DA)(DC)
>Entity 3
(DT)(DG)(DT)(DC)(DC)(DA)(3DR)(DG)(DT)(DC)(DT)
|
|
| PDBID: | 8wkf | | Status: | HPUB -- hold until publication | | Title: | Rational Design of Highly Selective PDE5 inhibitors for the Treatment of Idiopathic Pulmonary Fibrosis | | Authors: | Zhang, F.C, Huang, Y.Y | | Deposition date: | 2023-09-27 |
|
| PDBID: | 9bs3 | | Status: | HPUB -- hold until publication | | Title: | Wild type DNA Ligase 1 with 5''-rG:C | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-05-12 |
|
| PDBID: | 8wke | | Status: | HPUB -- hold until publication | | Title: | Sulfate-bound SARS-CoV-2 Nsp9 | | Authors: | Chen, P.J., Huang, H.Y., Hsiao, W.C., Huang, C.Y. | | Deposition date: | 2023-09-27 |
|
| PDBID: | 9bs4 | | Status: | HPUB -- hold until publication | | Title: | DNA Ligase 1 E346A/E592A double mutant with 5''-rG:C | | Authors: | KanalElamparithi, B., Caglayan, M. | | Deposition date: | 2024-05-12 |
|
| PDBID: | 8wk7 | | Status: | HPUB -- hold until publication | | Title: | Aldo-keto reductase KmAKR - Y28A/K29H/T63M/Y296W/W297H | | Authors: | Xu, S.Y., Zhou, L., Xu, Y., Wang, Y.J., Zheng, Y.G. | | Deposition date: | 2023-09-27 |
|
| PDBID: | 9bsj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bs9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8wk9 | | Status: | HPUB -- hold until publication | | Title: | Aldo-keto reductase KmAKR - Y28A/K29H/T63M/Q213A/Y296W/W297H | | Authors: | Xu, S.Y., Zhou, L., Xu, Y., Wang, Y.J., Zheng, Y.G. | | Deposition date: | 2023-09-27 |
|
| PDBID: | 9bsu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8wka | | Status: | HPUB -- hold until publication | | Title: | Aldo-keto reductase KmAKR - T23V/Y28A/K29H/T63M/Q213A/Y296W/W297H | | Authors: | Xu, S.Y., Zhou, L., Xu, Y., Wang, Y.J., Zheng, Y.G. | | Deposition date: | 2023-09-27 |
|
| PDBID: | 9bsv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8wkd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-27 |
|
| PDBID: | 9bs5 | | Status: | HPUB -- hold until publication | | Title: | Bacteroides ovatus GH97C Sus | | Authors: | Brown, H.A., Koropatkin, N.M. | | Deposition date: | 2024-05-13 | | Sequence: | >Entity 1
MHHHHHHQQKLTSPDGNLVLTFQVNKEGAPTYDLTYKGKVVIKPSTLGLELKKEDNTRTDFDWVDRRDLTKLDSKSNLYNGFKLKDAQTTTFDETWQPVWGEEKEIRNQYNELAVILFQPMNDRSIVVRFRLFNDGLGFRYEFPQQKSLNYFVIKEEHSQFAMAGNHIAYWIPGDYDTQEYDYTISRLSEIRGLMQQAITPNSSQTPFSPTGVQTALMMKTDDGLYINLHEAALIDYSCMHLNLDDKNMIFESWLTPDAKGDKGYMQTPCNSPWRTIIVSDDARNILASRITLNLNEPCKIADAASWIKPVKYIGVWWDMITGKGSWAYTDELTSVKLGVTDYSKTKPNGKHSANTANVKRYIDFAAANGFDAVLVEGWNEGWEDWFGNSKDYVFDFLTAYPDFDVQEIHRYAASKGIKMMMHHETSASVRNYERHLDKAYQFMVDNGYNSVKSGYVGNIIPRGEHHYGQWMNNHYLYAVKKAADYKIMVNAHEATRPTGICRTYPNLIGNESARGTEYESFGGNKVYHTTILPFTRLVGGPMDYTPGIFETHCNQMNPANNSQVRSTIARQLALYVTMYSPLQMAADIPENYERFMDAFQFIKDVALDWDKTIYLEAEPGEYITIARKAKGTDDWYIGCTAGENGHDSQLTFDFLEPGKQYVATVYADAKDADWKDNPQAYTIKKGILNNKSKLNLHAANGGGYAISIKEVKNKSEVKGLKRL
|
|
| PDBID: | 8wkc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of OgBVMO(Oceanicola granulosus) | | Authors: | Du, Y., Wang, Y.H. | | Deposition date: | 2023-09-27 |
|
| PDBID: | 8wki | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-27 |
|
| PDBID: | 9bs6 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of ThermoCas9 in post-cleavage state with a DNA containing NNNNCGA PAM | | Authors: | Zhao, Y., Shu, Y. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 8wkm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-28 |
|
| PDBID: | 9bsh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 | | Sequence: | >Entity 1
MNNSKIISKVLLSLSLFTVGASAFVIQDELMQKKHAKAEVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFAHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
|
|
| PDBID: | 8wkk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-28 |
|
| PDBID: | 8wkq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-28 |
|
| PDBID: | 9bsl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
