| PDBID: | 8v18 | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound AMPCPP | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 9b80 | | Status: | HPUB -- hold until publication | | Title: | Human endogenous FASN with 1,3-DBP - Class 1 focused modifying domain | | Authors: | Choi, W., Li, C., Chen, Y., Wang, Y., Cheng, Y. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9b7z | | Status: | HPUB -- hold until publication | | Title: | Human endogenous FASN with 1,3-DBP - Class 1 focused condensing domain | | Authors: | Choi, W., Li, C., Chen, Y., Wang, Y., Cheng, Y. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8v1a | | Status: | HPUB -- hold until publication | | Title: | RNA polymerase II elongation complex with 8-oxoguanine and ATP in two different conformation: 8OG (syn)-ATP (A site) and 8OG (anti)-ATP (E site) | | Authors: | Oh, J., Wang, D. | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9b81 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of wild type IDH1 bound to compound 4 | | Authors: | Lu, J., Abeywickrema, P., Heo, M.R., Parthasarathy, G., McCoy, M., Soisson, S.M. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8v1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9b82 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8v1c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I3 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9b84 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human ADAR1 in complex with dsRNA derived from HT2C gene | | Authors: | Deng, X., Gao, Y. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8v1d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I25 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9b8b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 8v1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 9b8c | | Status: | HPUB -- hold until publication | | Title: | RM018 Fab in complex with Apex GT 6.2 trimer and RM20A3 Fab | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 9b8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-30 |
|
| PDBID: | 8v1w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v1v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8v22 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9b8l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-30 |
|
| PDBID: | 9b8s | | Status: | HPUB -- hold until publication | | Title: | Human polymerase epsilon bound to PCNA and DNA in the nucleotide exchange state | | Authors: | Wang, F., He, Q., Li, H. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 9b8m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor | | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 9b8n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ornithine decarboxylase in complex with a novel inhibitor (10-S) | | Authors: | Schultz, C.R., Aleiwi, B., Zhou, X.E., Suino-Powell, K., Melcher, K., Brunzelle, J.S., Almeida, N.M.S., Wilson, A.K., Ellsworth, E., Bachmann, A.S. | | Deposition date: | 2024-03-31 |
|
| PDBID: | 8v1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9b96 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
| PDBID: | 9b97 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-01 |
|
