| PDBID: | 9bl9 | | Status: | HPUB -- hold until publication | | Title: | KIR3DL1*114 in complex with HLA-A*24:02 presenting the NEF peptide | | Authors: | Faoro, C., Rossjohn, J. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9ba1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-02 | | Sequence: | >Entity 1
MKKLLIAAGSVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIALHHHHHH
>Entity 2
MKKLLIAAGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMYWVRQAPGKGLEWVSKINTNGLITKYPDSVKGRFTISRDNAKNTLYLQMNSLRPEDTAVYYCARSPSGFNRGQGTLVTVSSHHHHHH
|
|
| PDBID: | 9b9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
| PDBID: | 8w8g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human TRF1 with PinX1 | | Authors: | Lei, M., Wu, J. | | Deposition date: | 2023-09-02 |
|
| PDBID: | 9b9q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w8h | | Status: | HPUB -- hold until publication | | Title: | 2-Ketoglutarate-Dependent Dioxygenase | | Authors: | Zheng, C.N., Wei, W.Q. | | Deposition date: | 2023-09-02 |
|
| PDBID: | 9b9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w8j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-19 | | Authors: | Luo, Z., Zhou, H. | | Deposition date: | 2023-09-03 |
|
| PDBID: | 9b9t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40407 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w8l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-38 | | Authors: | Luo, Z., Zhou, H. | | Deposition date: | 2023-09-03 |
|
| PDBID: | 9b9w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40792 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 |
|
| PDBID: | 9ba2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the binary complex of DCAF1 and WDR5 | | Authors: | Mabanglo, M.F., Vedadi, M., Al-awar, R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w90 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 | | Release date: | 2024-09-04 |
|
| PDBID: | 8w91 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin mutant - H2KE exposed to H2O2 for 3 min | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8z | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli ferritin mutant-M52H | | Authors: | Zhao, G., Zeng, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 9ba6 | | Status: | HPUB -- hold until publication | | Title: | High-resolution crystal structure of Vibrio cholerae NFeoB in the apo form | | Authors: | Lee, M., Smith, A.T. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w92 | | Status: | HPUB -- hold until publication | | Title: | human H ferritin with 2 Fe(II)/subunit loading | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w93 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 9ba7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Vibrio cholerae N150T NFeoB variant with a single GDP molecule bound | | Authors: | Lee, M., Smith, A.T. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w94 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 2 s | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w95 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 20 s | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 9baa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
