PDBID: | 8uud | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-01 |
|
PDBID: | 9arm | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-23 |
|
PDBID: | 8uut | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-01 |
|
PDBID: | 9arw | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-23 |
|
PDBID: | 9axq | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8uve | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-02 |
|
PDBID: | 8uvy | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-05 |
|
PDBID: | 9axu | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 9axs | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8uxp | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-09 |
|
PDBID: | 9ay6 | Status: | HPUB -- hold until publication | Title: | HIV BG505.v5.2 (N289/N241) SOSIP Env in Complex with V5 pAb from Rh.33203 | Authors: | Brown, S., Antansijevic, A., Ward, A.B. | Deposition date: | 2024-03-07 |
|
PDBID: | 8uxo | Status: | HPUB -- hold until publication | Title: | Caulobacter crescentus FljK flagellar filament (symmetrized) | Authors: | Sanchez, J.C., Montemayor, E.J., Ploscariu, N.T., Parrell, D., Baumgardt, J.K., Yang, J.E., Sibert, B., Cai, K., Wright, E.R. | Deposition date: | 2023-11-09 |
|
PDBID: | 8uxd | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-09 |
|
PDBID: | 8uxb | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-09 |
|
PDBID: | 9ayi | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-07 |
|
PDBID: | 8ux8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-09 |
|
PDBID: | 8ux9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-09 |
|
PDBID: | 9au5 | Status: | HPUB -- hold until publication | Title: | Ternary complex of human DNA polymerase theta polymerase domain with a cognate G:C base pair | Authors: | Li, C., Gao, Y. | Deposition date: | 2024-02-28 |
|
PDBID: | 8uxq | Status: | HPUB -- hold until publication | Title: | Structure of Heterochromatin Protein 1 (HP1) alpha in complex with an H2A.Z nucleosome | Authors: | Tan, D., Sokolova, V. | Deposition date: | 2023-11-09 |
|
PDBID: | 9au4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8uyn | Status: | HPUB -- hold until publication | Title: | Fundamental Characterization of Chelated and Crystallized Actinium in a Macromolecular Host | Authors: | Rupert, P.B., Strong, R.K. | Deposition date: | 2023-11-13 | Sequence: | >Entity 1 QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
|
|
PDBID: | 9au8 | Status: | HPUB -- hold until publication | Title: | Ternary complex of human DNA polymerase theta polymerase domain with a mismatched T:T base pair | Authors: | Li, C., Gao, Y. | Deposition date: | 2024-02-28 |
|
PDBID: | 8tfd | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-10 | Release date: | 2025-01-08 |
|
PDBID: | 9au7 | Status: | HPUB -- hold until publication | Title: | Human Retriever VPS35L/VPS29/VPS26C complex bound to SNX17 peptide (Composite Map) | Authors: | Chen, B., Chen, Z., Han, Y., Boesch, D.J., Juneja, P., Burstein, E., Fung, H.Y.J. | Deposition date: | 2024-02-28 |
|
PDBID: | 8uvb | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-02 |
|