| PDBID: | 8reg | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8ymt | | Status: | HPUB -- hold until publication | | Title: | Structure of BRTNaC1 at low pH with testosterone | | Authors: | Chen, X., Su, N., Yuan, L. | | Deposition date: | 2024-03-10 |
|
| PDBID: | 8rel | | Status: | HPUB -- hold until publication | | Title: | Fab of an anti-PvAMA1 monoclonal antibody | | Authors: | Bentley, G.A., Saul, F.A., Vulliez-LeNormand, B. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8ymu | | Status: | HPUB -- hold until publication | | Title: | Acid activated state of BRTNaC1 | | Authors: | Chen, X., Su, N., Yuan, L. | | Deposition date: | 2024-03-10 |
|
| PDBID: | 8reh | | Status: | HPUB -- hold until publication | | Title: | Lysozyme measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8ymz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 8rei | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a silicon HARE-chip. | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 9fx7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-01 |
|
| PDBID: | 8ymy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 8rej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR gamma Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-11 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
|
|
| PDBID: | 8rem | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (50 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2023-12-11 |
|
| PDBID: | 8yn3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 8rew | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8yn4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 8rex | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8yn5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 8ren | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8yn6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 8reo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8rfj | | Status: | HPUB -- hold until publication | | Title: | DNA bound type IV-A1 CRISPR effector complex with the DinG helicase from P. oleovorans | | Authors: | Miksys, A., Cepaite, R., Malinauskaite, L., Pausch, P. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8res | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8yn9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 8ret | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
| PDBID: | 8yna | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-10 |
|
| PDBID: | 8reu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-12 |
|
