PDBID: | 8kdp | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8xrp | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 | Sequence: | >Entity 1 LSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASHHHHHH
>Entity 2 AIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
>Entity 3 KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEHHHHHH
>Entity 4 CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPHHHHHH
|
|
PDBID: | 9fe7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-17 |
|
PDBID: | 8kdq | Status: | HPUB -- hold until publication | Title: | De novo design protein -T03 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-09 |
|
PDBID: | 8xrl | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 9fe8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-17 |
|
PDBID: | 8q5y | Status: | HPUB -- hold until publication | Title: | cryoEM structure of SARS-CoV2 Spike trimer in complex with Fab23 | Authors: | Hallberg, M., Das, H. | Deposition date: | 2023-08-10 |
|
PDBID: | 8xrn | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 9fea | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-17 |
|
PDBID: | 8q65 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 9fed | Status: | HPUB -- hold until publication | Title: | Single-chain chimeric protein mimicking the interaction between HR1 and HR2 in HIV gp41 | Authors: | Camara-Artigas, A., Gavira, J.A., Conejero-Lara, F., Polo-Megias, D. | Deposition date: | 2024-05-18 |
|
PDBID: | 8q64 | Status: | HPUB -- hold until publication | Title: | Crystal structure of hydroxylated HIF2alpha-CODD peptide (523-542) bound to apo-HIF prolyl hydroxylase 2 (PHD2 181-407) | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | Deposition date: | 2023-08-10 |
|
PDBID: | 8xrg | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 8kdu | Status: | HPUB -- hold until publication | Title: | Crystal structure of trypsin with its substrate | Authors: | Akbar, Z., Ahmad, M.S. | Deposition date: | 2023-08-10 |
|
PDBID: | 8xri | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 9feg | Status: | HPUB -- hold until publication | Title: | PARP15 in complex with a quinazolin-4-one inhibitor | Authors: | Bosetti, C., Lehtio, L. | Deposition date: | 2024-05-20 |
|
PDBID: | 8xrf | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 9f5n | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-29 |
|
PDBID: | 8xrh | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 9eum | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8kdr | Status: | HPUB -- hold until publication | Title: | The local refined map of SARS-CoV-2 XBB Variant Spike protein complexed with antibody PW5-535 | Authors: | Sun, L., Mao, Q., Wang, Y. | Deposition date: | 2023-08-10 |
|
PDBID: | 8xrk | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-07 |
|
PDBID: | 9fda | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-16 |
|
PDBID: | 8kds | Status: | HPUB -- hold until publication | Title: | Trimer state of SARS-CoV Spike protein complexed with antibody PW5-535 | Authors: | Sun, L., Mao, Q., Wang, Y. | Deposition date: | 2023-08-10 |
|
PDBID: | 9eov | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-15 |
|