| PDBID: | 8qgh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8yb8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 9ewr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8qgi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 9f2s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-23 |
|
| PDBID: | 8qgj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 9fbp | | Status: | HPUB -- hold until publication | | Title: | Deletion mutant MmChi60 | | Authors: | Rypniewski, W., Bejger, M., Biniek-Antosiak, K. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8qgk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8ybi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 |
|
| PDBID: | 9fbq | | Status: | HPUB -- hold until publication | | Title: | Deletion mutant of chitinase MmChi60 | | Authors: | Malecki, P.H., Rypniewski, W. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8ybl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 8qgl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 9fbr | | Status: | HPUB -- hold until publication | | Title: | Deletion mutant of chitinase MmChi60 | | Authors: | Bejger, M., Rypniewski, W. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8qgm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8ybn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9fbs | | Status: | HPUB -- hold until publication | | Title: | Deletion mutant of chitinase MmChi60 | | Authors: | Bejger, M., Rypniewski, W. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8qgn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8ybo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 8qgo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8ybp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9fbh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8qgv | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase I in complex with 4-(5-acetyl-6-methyl-2-oxo-1,2,3,4-tetrahydropyrimidin-4-yl)benzenesulfonamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-09-05 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9fbi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8ota | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-20 | | Release date: | 2024-10-20 |
|
| PDBID: | 8qh5 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of UVSSA(VHS)-CSA-DDB1-DDA1 | | Authors: | Lee, S.-H., Sixma, T.K. | | Deposition date: | 2023-09-06 |
|
