| PDBID: | 9era | | Status: | HPUB -- hold until publication | | Title: | Hydrogenase-1 Ni-Lii state | | Authors: | Wong, K.L., Carr, S.B., Ash, P.A., Vincent, K.A. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8cqw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-07 | | Release date: | 2024-09-07 |
|
| PDBID: | 8xlt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of NleA oligomer | | Authors: | Machida, S., Sivaraman, J. | | Deposition date: | 2023-12-26 |
|
| PDBID: | 8xlh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-26 |
|
| PDBID: | 9eq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8xls | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-26 |
|
| PDBID: | 9ept | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Plastid Redox Insensitive 2 from Arabidopsis thaliana | | Authors: | Ruedas, R., Vallet, A., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8cre | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-08 | | Release date: | 2024-09-08 |
|
| PDBID: | 8xlz | | Status: | HPUB -- hold until publication | | Title: | beta-1,4-galacosyltransferase | | Authors: | Luo, G., Huang, Z., Chen, J., Hou, X., Zhu, Y., Ni, D., Xu, W., Zhang, W., Rao, Y., Mu, W. | | Deposition date: | 2023-12-26 |
|
| PDBID: | 9eq6 | | Status: | HPUB -- hold until publication | | Title: | Cachd1 and FZD5 complex | | Authors: | Zhao, Y., Ren, J., Jones, E.Y. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8xlw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD+BBC-OH complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2023-12-26 |
|
| PDBID: | 9eqs | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 100uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8xlx | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with LB600 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-12-26 |
|
| PDBID: | 9eqq | | Status: | HPUB -- hold until publication | | Title: | Uhgb_MS mannoside synthase from an unknown human gut bacterium in complex with Mannose | | Authors: | Cioci, G., Ladeveze, S., Potocki-Veronese, G. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8xly | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-Phe complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2023-12-26 |
|
| PDBID: | 9erk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 9erz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9esi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ghw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-12 | | Release date: | 2024-09-12 |
|
| PDBID: | 9ep7 | | Status: | HPUB -- hold until publication | | Title: | Poecitoxin-1a from Poecilotheria subfusca spider, a new potent peptide blocker of the human Cav1.2 channel subtype | | Authors: | Kurz, M., Kurz, M. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8xm3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-27 |
|
| PDBID: | 9epd | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 8 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8xm4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-27 |
|
| PDBID: | 9epg | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9eph | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
