| PDBID: | 8toz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 |
|
| PDBID: | 8z8h | | Status: | HPUB -- hold until publication | | Title: | The complex structure of HnH6H, 2OG and hyoscyamine. | | Authors: | Wu, L., Zhou, J.H. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tpw | | Status: | HPUB -- hold until publication | | Title: | Crosslinked 6-deoxyerythronolide B synthase (DEBS) Module 3 in complex with antibody fragment 1B2: cis-oriented 1B2 and ACP | | Authors: | Cogan, D.P., Soohoo, A.M., Chen, M., Brodsky, K.L., Liu, Y., Khosla, C. | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8z8i | | Status: | HPUB -- hold until publication | | Title: | The quaternary complex structure of HnH6H, iron,AKG and C6 hydroxylated intermediate. | | Authors: | Wu, L., Zhou, J.H. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tpu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-05 |
|
| PDBID: | 8z8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tq4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8z8z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8z8p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8z99 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tq1 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 BG505 Env SOSIP in complex with bovine Fab Bess4 and non-human primate Fab RM20A3 | | Authors: | Ozorowski, G., Lee, W.H., Ward, A.B. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8z8r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tqf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Soybean SHMT8 in complex with PLP-glycine and diglutamylated 5-formyltetrahydrofolate | | Authors: | Owuocha, L.F., Beamer, L.J. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8z8m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human TNF alpha in complex with TNF30(VHH) domain of ozoralizumab | | Authors: | Mima, M., Mishima-Tsumagari, C. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tqj | | Status: | HPUB -- hold until publication | | Title: | MPI57 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8z8v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human serum albumin in complex with ALB8(VHH) domain of ozoralizumab | | Authors: | Mima, M., Mishima-Tsumagari, C. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tql | | Status: | HPUB -- hold until publication | | Title: | MPI54 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8z8w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8z93 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of amyloid fibril formed by human RIPK1 RHIM protein | | Authors: | Ma, Y., Zhao, K., Liu, C. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8z94 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of RIPK1 RHIM PFFs cross seeded RIPK3 RHIM amyloid fibril | | Authors: | Ma, Y., Zhao, K., Liu, C. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tqy | | Status: | HPUB -- hold until publication | | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | | Deposition date: | 2023-08-08 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8z9n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-23 |
|
| PDBID: | 8tqt | | Status: | HPUB -- hold until publication | | Title: | MPI52 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-08 |
|
