| PDBID: | 8z63 | | Status: | HPUB -- hold until publication | | Title: | alpha-L-fucosidase from Pontiella sulfatireligans F21 | | Authors: | Zhao, P., Bai, L., Wang, S. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8t7o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the R132H mutant of IDH1 bound to AG-120 | | Authors: | Lu, J., Abeywickrema, P., Heo, M.R., Parthasarathy, G., McCoy, M., Soisson, S.M. | | Deposition date: | 2023-06-20 |
|
| PDBID: | 8tbc | | Status: | HPUB -- hold until publication | | Title: | Structure of a de novo designed interleukin-21 mimetic complex with IL-21R and IL-2Rg | | Authors: | Abhiraman, G.C., Jude, K.M., Garcia, K.C. | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-28 |
|
| PDBID: | 8z68 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR68-Gs complex in pH6.8 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tb9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-28 | | Release date: | 2024-12-18 |
|
| PDBID: | 8z5k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tbr | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Dihydrofolate reductase (DHFR) from Mycobacterium ulcerans Agy99 in complex with NADP and inhibitor MAM758 | | Authors: | Seattle Structural Genomics Center for Infectious Disease, Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2023-06-29 |
|
| PDBID: | 8z5b | | Status: | HPUB -- hold until publication | | Title: | The X-Ray crystal structure of multicopper oxidase from Bacillus freudenreichii | | Authors: | Qian, H., Wang, Y. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tf0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-15 |
|
| PDBID: | 8tf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8z67 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR68-Gs complex in pH6.8 | | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tez | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH | | Authors: | Donkor, A.K., Safo, M.K., Musayev, F.N. | | Deposition date: | 2023-07-07 |
|
| PDBID: | 8z5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tfd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-08 |
|
| PDBID: | 8z5m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tfj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-11 |
|
| PDBID: | 8z5r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tg9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-12 |
|
| PDBID: | 8z5g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tga | | Status: | HPUB -- hold until publication | | Title: | Complex of NPR1 ectodomain and REGN5381 Fab in an active-like state with no ANP bound | | Authors: | Franklin, M.C., Romero Hernandez, A. | | Deposition date: | 2023-07-12 |
|
| PDBID: | 8z5u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8tg0 | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of the cold shock domain of the Arabidopsis thaliana glycine-rich protein AtGRP2 | | Authors: | Pougy, K.C., Almeida, F.C.L., Pinheiro, A.S. | | Deposition date: | 2023-07-12 | | Release date: | 2025-01-12 |
|
| PDBID: | 8z54 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human SIRT5 in complex with succinylated Prx1 fragment | | Authors: | Yokoyama, T., Takayama, Y. | | Deposition date: | 2024-04-18 | | Sequence: | >Entity 1
MHHHHHHPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALA
>Entity 2
SKEYFSKQK
|
|
