PDBID: | 8qoo | Status: | HPUB -- hold until publication | Title: | Crystal structure of human Sirt2 in complex with the peptide-based pseudo-inhibitor TNFn-4.1 | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | Deposition date: | 2023-09-29 |
|
PDBID: | 8y8v | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 8qp1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-29 |
|
PDBID: | 8y8o | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 8qp2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-29 |
|
PDBID: | 8y8p | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 8qp3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-29 |
|
PDBID: | 8y8q | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 8qp4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-29 |
|
PDBID: | 8y8r | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 8qp6 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Hepatitis C Virus E1 glycoprotein epitope 314-324 scaffold design 1W4K_08 in complex with neutralizing antibody F(ab) fragment IGH526 | Authors: | Nagarathinam, K., Krey, T. | Deposition date: | 2023-09-30 | Sequence: | >Entity 1 MGSREVATPHRAAWLAMMLGIDASKVKGTGPGGVITVEDVKRWAEETAKATAGSENLYFQ
>Entity 2 EVQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGSLEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEKEIELTLTQPASASATPGQRVTISCSGSSSNIGGNTVNWYQHLPGAAPKLLIHNNDLRPSGVPDRFSGSKSGTSASLAVSGLQSEDEADYFCAAWDDGLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
|
|
PDBID: | 8y8s | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 9fqz | Status: | HPUB -- hold until publication | Title: | CRYO-EM STRUCTURE OF HCT15 POLYSOMES BOUND TO EEF2, EBP1, AND SERBP1 | Authors: | Rajan, K.S., Yonath, A. | Deposition date: | 2024-06-17 |
|
PDBID: | 8qp7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Hepatitis C Virus E2 glycoprotein epitopeI 411-424 scaffold design 4CIL_04 | Authors: | Nagarathinam, K., Cramer, J.T., Krey, T. | Deposition date: | 2023-09-30 |
|
PDBID: | 8y8w | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 8qpo | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-02 |
|
PDBID: | 8y8x | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 8qpg | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-02 |
|
PDBID: | 8y9h | Status: | HPUB -- hold until publication | Title: | Crystal structure of the C terminal domain of EF-hand domain-containing protein 1 | Authors: | Chueh, C.K., Wei, J.H. | Deposition date: | 2024-02-06 |
|
PDBID: | 8qpq | Status: | HPUB -- hold until publication | Title: | C1 turret to baseplate interface of full Haloferax tailed virus 1 adjacent to the portal-capsid interface. | Authors: | Zhang, D., Daum, B., Isupov, M.N., McLaren, M. | Deposition date: | 2023-10-02 |
|
PDBID: | 8y8e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 8qpv | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-03 |
|
PDBID: | 8y8m | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|
PDBID: | 9fqt | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the apo inward-open state | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | Deposition date: | 2024-06-17 |
|
PDBID: | 8y8j | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-06 |
|